KEGG   Polaromonas naphthalenivorans: Pnap_3649Help
Entry
Pnap_3649         CDS       T00459                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01130  Biosynthesis of antibiotics
pna01230  Biosynthesis of amino acids
Module
pna_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pnap_3649
Enzymes [BR:pna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pnap_3649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C Vps8
Motif
Other DBs
NCBI-ProteinID: ABM38945
UniProt: A1VTG7
Position
complement(3884593..3885384)
Genome map
AA seq 263 aa AA seqDB search
MSDILNKIIAVKREEITDAINRKPLPAMRKDAESRVLTRDFVGALRAKIAAGKPAVIAEI
KKASPSKGVLRADFIPADIAQSYAEFGAACLSVLTDQQFFQGSIDYLKQARASCSLPVLR
KDFIIDAYQVYESRVMGADCILLIAACLDDAQMKTLEALAMSLDMAVLVEVHDEAELERA
LKLRTPLIGINNRNLNTFEVSLDTTLRLMGKVPAERLLVTESGITTPEDVKRMRDARVNA
FLVGEAFMRADEPGVALAELFGE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctgaacaagatcattgccgtcaagcgcgaagaaatcaccgacgccatc
aaccgcaaacccctgcccgccatgcgcaaggacgccgagtcgcgcgtgctgacgcgggac
tttgtcggcgccctgcgcgccaagatcgccgccggcaagccggccgtgattgccgaaatc
aagaaggccagcccgtccaagggcgtgctgcgcgccgacttcattcccgccgacatcgcc
cagagctatgccgagttcggcgctgcctgcctgtcggtgctgaccgaccagcagtttttc
cagggcagcatcgactacctgaagcaggcgagggcgtcgtgcagcctgccggtgctgcgc
aaggacttcatcatcgacgcctaccaggtctatgagtcccgcgtcatgggcgccgactgc
attttgctgatcgccgcctgcctggacgacgcacagatgaagaccctcgaagcactggcg
atgtcgctcgacatggcggtgctggtcgaggtgcatgacgaggcggagctggagcgcgcg
ctcaagctcaggacgcccctgatcggcatcaacaaccgcaacctgaacactttcgaggtt
tcgctggacacgaccttgaggctgatgggcaaggtgcccgcagagcgcctgctggtcacc
gagtcaggcatcacgacgcctgaagatgtcaaacgcatgcgggacgccagggtcaacgcc
ttcctggtcggcgaagctttcatgcgggcagacgaaccgggcgttgcgctggccgaactg
tttggcgagtaa

DBGET integrated database retrieval system