KEGG   Polaromonas naphthalenivorans: Pnap_4147
Entry
Pnap_4147         CDS       T00459                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K08690  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [EC:1.3.1.56]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00621  Dioxin degradation
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Pnap_4147
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.56  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
     Pnap_4147
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD Epimerase Polysacc_synt_2 TrkA_N AlaDh_PNT_C Methyltransf_25
Other DBs
NCBI-ProteinID: ABM39434
UniProt: A1VUV6
Position
pPNAP01:complement(21312..22142)
AA seq 276 aa
MKLTGEVVLITGGASGLGRALVDRFVAEGARVAVLDKSAERLQQMESDHGDKVVGIVGDV
RSLQDQKQAADRCVAKFGKIDTLIPNAGIWDYSTALVDLPEDRIDAAFDEVFHINVKGYI
HAVKACLPALVASRGSVIFTLSNAGFYSNGGGPLYTAAKHAVVGLVRELAFELAPYVRVN
GVAPGGMSTDLRGPSSLGMSGQAISTVPLADMLESVLPIGRMPDTEEYTGAYVFFATRGD
TVPATGALLNYDGGMGVRGFFSAAGGKDLLEKLNIK
NT seq 831 nt   +upstreamnt  +downstreamnt
atgaaattgacaggtgaagtggtattgatcacgggcggcgcctccggcctggggcgcgcc
ctggtggaccggttcgttgccgaaggcgccagggtggcggtgctcgacaagtcggcggag
cggctccagcaaatggaatccgaccacggtgacaaggtggtcggcatcgtcggcgacgtg
cgctcactgcaagaccagaaacaggccgccgaccgctgcgtggccaagttcggaaaaatc
gacaccctgattcccaacgcgggcatctgggactactcgacggcgctggtcgatctgccg
gaagaccgcatcgatgccgcgttcgacgaggtctttcacatcaatgtcaaaggctatatc
cacgccgtcaaggcctgtctgccggccctggtcgccagccgtggcagcgtgatcttcacg
ctctcgaatgcgggcttctattccaatggtggcggccctctttacaccgcagccaagcac
gcggtggtgggcctagtgcgcgagttggcgtttgagctggcgccgtacgtgcgcgtcaac
ggcgtggcaccgggcggcatgagcaccgatttgcgcggcccttcctcgcttggcatgagc
ggtcaagcgatttcgaccgtgccgctggccgacatgctggagtccgtgctgccgattggc
cgcatgcctgacaccgaggagtacaccggtgcctatgtgttttttgccacgcgaggcgat
acggtacccgctaccggcgccttgctgaactacgacggcggcatgggcgtgcgtggattt
ttctcggcagcagggggcaaggacttgctcgaaaaactgaatatcaaataa

DBGET integrated database retrieval system