KEGG   Polaromonas naphthalenivorans: Pnap_4149
Entry
Pnap_4149         CDS       T00459                                 

Definition
(GenBank) Rieske (2Fe-2S) domain protein
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00621  Dioxin degradation
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Pnap_4149
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: ABM39436
UniProt: A1VUV8
Position
pPNAP01:complement(23408..23737)
AA seq 109 aa
MEFTRVCSLSEVPQGEALKVESGDTAVAIFNVEGELFATQDRCTHGEWSLAEGGYLDGDV
VECSLHMGKFCVRTGKVKSPPPCVPLKIFPIRIEGNDVFVDFNAGHLAP
NT seq 330 nt   +upstreamnt  +downstreamnt
atggaattcacccgagtttgcagtttgagcgaggtgccgcagggcgaagccctgaaggtc
gaaagtggcgacaccgccgtcgcaattttcaatgtggagggtgagctgttcgcgacgcag
gaccgctgcacccatggcgaatggtctctggccgagggcggctatctcgacggcgacgtt
gtggaatgctcactgcacatgggcaagttttgtgttcgcacgggcaaggtcaagtcgccg
ccgccttgtgtgccgttgaaaatattcccgatccgtatcgagggcaatgacgtgtttgtt
gacttcaatgccgggcacctggcgccatga

DBGET integrated database retrieval system