KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_0035Help
Entry
NCGM2_0035        CDS       T01974                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00260  Glycine, serine and threonine metabolism
pnc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pnc01100  Metabolic pathways
pnc01110  Biosynthesis of secondary metabolites
pnc01130  Biosynthesis of antibiotics
pnc01230  Biosynthesis of amino acids
Module
pnc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCGM2_0035 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCGM2_0035 (trpA)
Enzymes [BR:pnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NCGM2_0035 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: BAK86927
Position
1:complement(37166..37972)
Genome map
AA seq 268 aa AA seqDB search
MSRLQTRFAQLKQENRAALVTFVTAGDPDYASSLEILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALDGGQTLARTLQMVREFRSGDSETPLVLMGYFNPIHHYGVERFIAEAKE
VGVDGLIVVDLPPEHNEDLCHPAQAAGLDFIRLTTPTTGDQRLPTVLEGSSGFVYYVSVA
GVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAEHAAAVARLADGVVVGSALIDRI
AKARDNAQAVKDVLALCGELAEGVRNAR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcagacccgcttcgcccagctcaagcaggaaaaccgcgccgccctggtg
accttcgtcaccgccggcgacccggactacgcgtcttccctggaaatcctcaaaggcctg
ccggcggccggagccgacgtgatcgaactgggcatgccgttcaccgatccgatggcggac
ggcccggccatccagttggccaacatccgcgccctcgacggcggccagaccctggccagg
acgttgcagatggtccgcgaattccgcagcggcgacagcgagacacccctggtgctgatg
ggctacttcaacccgatccaccactacggcgtcgagcgcttcatcgccgaggcgaaggag
gtgggggtggacggcctgatcgtggtcgacctgccgccggagcacaacgaagacctctgc
cacccggcccaggccgccggcctcgacttcatccgcctgaccaccccgaccaccggcgac
cagcgcctgccgacggtgctcgaaggcagttccgggtttgtctactacgtgtcggtggcc
ggcgtcaccggcgccaacgcggcgaccctggaacacgtcgaggaagcggtggcgcgcctg
cgccggcataccgacctgccgatcggtatcggcttcggcatccgcagcgccgaacacgcc
gccgcggtcgcgcggttggccgacggcgtggtggtcggctcggcgctgatcgaccggatc
gccaaggcccgcgacaatgcccaggcggtcaaggatgtcctcgccctgtgcggcgagctg
gccgaaggcgtgcgcaacgcacgctga

DBGET integrated database retrieval system