KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_0347Help
Entry
NCGM2_0347        CDS       T01974                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00250  Alanine, aspartate and glutamate metabolism
pnc00310  Lysine degradation
pnc00650  Butanoate metabolism
pnc01100  Metabolic pathways
pnc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    NCGM2_0347 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCGM2_0347 (gabT)
   00310 Lysine degradation
    NCGM2_0347 (gabT)
Enzymes [BR:pnc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NCGM2_0347 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     NCGM2_0347 (gabT)
Amino acid related enzymes [BR:pnc01007]
 Aminotransferase (transaminase)
  Class III
   NCGM2_0347 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAK87239
Position
1:complement(387913..389193)
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREYIDFAGGIAVLNTGHLH
PKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDFPKKTLLVTSGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALAPCELHGVS
EDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKSFMQRLRALCDQHGILLIAD
EVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFPISGVAGKAEIMDAIAPGGLGGTYA
GSPIACAAALAVLKVFEEEKLLERSQALGERLKAGLREIQAKHKVIGDVRGLGSMVAIEL
FEGGDTHKPAAELVSKIVVRAREKGLILLSCGTYYNVIRFLMPVTIPDAQLEKGLAILAE
CFDELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccctgctgaagcgtcgccaggccgcggtaccccgcggcgtg
ggccagatccacccggtcgtcgccgagcgcgccgagaactccaccgtctgggacgtggaa
ggccgcgagtacatcgacttcgccggcggcatcgccgtgctgaacaccggccacctgcat
ccgaaggtgatcgccgcggtccaggagcaactgggcaagctgtcccacacctgcttccag
gtgctggcctacgaaccctacatcgagctggccgaggaaatcgccaagcgcgtgccgggc
gacttcccgaagaagaccctgctggtcacctccggctccgaagccgtcgagaacgccgtc
aagatcgcccgcgccgccaccggtcgcgctggcgtgatcgccttcaccggcgcctaccac
ggccgcaccatgatgaccctgggcctgaccggcaaggtggtcccgtactccgccggcatg
ggcctgatgccgggcggcatcttccgcgccctggcgccctgcgaactgcacggcgtgagc
gaggacgactccatcgccagcatcgagcgcatcttcaagaacgatgcccagccccaggac
atcgccgcgatcatcatcgagccggtgcagggcgagggtggcttctacgtcaactccaag
tccttcatgcagcgcctgcgcgccctttgcgaccagcacggcatcctgctgatcgccgac
gaagtgcagaccggcgccggccgtaccggcaccttcttcgctaccgagcaactgggcatc
gttcctgacctgaccacctttgccaagtcggtcggcggcggcttcccgatctccggcgtg
gccggcaaggccgagatcatggacgccatcgcgcccggcggcctgggcggcacctatgcc
ggcagcccgatcgcctgcgccgcggccctggccgtgctgaaggtgttcgaggaagagaag
ctgctggaacgttcgcaagccctcggcgagcgcctcaaggccggcctgcgcgagatccag
gccaagcacaaggtgatcggcgacgttcgtggcctgggttcgatggtggccatcgagctg
ttcgagggcggcgatacccacaagccggccgccgagctggtcagcaagatcgtcgtccgt
gcgcgcgagaagggcctgatcctgctctcctgcggcacctactacaacgtcatccgcttc
ctcatgcccgtcaccatccccgacgcgcaactggagaagggcctggccatcctggccgag
tgcttcgacgaactcgcttaa

DBGET integrated database retrieval system