KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_0421
Entry
NCGM2_0421        CDS       T01974                                 

Definition
(GenBank) hypothetical protein
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
SSDB
Motif
Pfam: PLDc_2 PLDc
Other DBs
NCBI-ProteinID: BAK87311
Position
1:466750..468987
AA seq 745 aa
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEA
ARHSIDIITWGFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGA
GVGGSGGTWAGSGVASGSAVDNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSF
DPRGAAHARARIAELEAENAENQRTFDSSEAQGYGGKRGSGGTRQDPWGQIFTRDWFKAV
RGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIHLLRADGIDDLGIGQLLVLTQ
FASHHQKMVLVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGFGPWQDISMQV
QGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQP
QDGERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVT
NTPDSSDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQ
ENNIERLERKIEALEQKGVTPEVEQRLGGLGAQEIPGLAKNTGEDDKPYQLAEVPGLKVV
VATLATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANI
NVRSMHGDSELGIAQPNPDLARAMREELWGAHVGRLAETTEKNFELWNQKMDDNWKAQVA
DEPFTSHLLRFWDVTTPYSQNLTVD
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgagcgacctgtacaaaccgcagaccctcaagctgtacgcgcaacaggccggcagcgtc
cggctgaccctcgactggttcgccaacaaggccttctacccaccgcgcgcgggtgtgcac
atcaagccgctgatcaatggccaggcggccttcgacgcggtgcatgcggccatggaagcg
gcccggcacagcatcgacatcatcacctggggcttcgacccggccatgcgcttcaagcgc
cccgacggaccgcgaataggcgaattgctgcagacgaagggccgcgaaggggtgcaggcg
cgggtgctggtctggagcaaccagctcgccaggctcaaggaaaacaccatccccggggcc
ggcgtcggcggttccggcggcacctgggcgggctcgggcgtcgccagcggcagcgcagtg
gacaacgaggtgctgcggctggagcagcggcgccagcataacctcaacctcatcgcgcgg
cagcaggaagccctggagcgctcggaacggctgcaccgcgaaggcaggctgccgagcttc
gacccgcggggcgccgcccacgcgcgggcgcgcatcgccgagctggaggcggagaacgcc
gagaaccagcgcactttcgacagcagcgaggcccagggctacggcggcaagcgcggttcc
ggcggcacccgccaggatccctgggggcagatattcacccgcgactggttcaaggcggta
cgcggcggtgggttgcagaacgtcgagttccgtacccgcgacttcgagcagacggccagg
ccggtgatgaacggcgagcaggtgcgcctcgtcaacgggcgactgcaaagcctgatccac
ctgctgcgcgccgatggcatcgacgacctgggcatcggccagttgctggtactcacccag
ttcgccagccatcaccagaagatggtcctggtcgactatggcagcccgcaggccatcggc
ttcgtcatgggtcacaacatgcaccgcaactactgggacaccagcgcccacctgttcgac
gaccgcgccgccggtcgcgatcccgggttcgggccctggcaggatatctccatgcaggtc
cagggaccggtgctggccgacctcagccgcaacttcagcgaggcctgggacctcgagacg
ccgtggtacaagcgctggttctcgacgccatcgctgaccgccgagcgcgacgccttgccg
ctgccgaagatcgccacgcccgccagcaacagcgtcgcgcagatttgccgaacccagcca
caggacggcgagcgctcgatcctggagcactatctcaaggccctgggcaatgccaccgac
tacgtctacatggaaaaccagtacttccgttatgccggcttcgccgagcgcctgcggaag
actgcgcaggtgcgcaaggcccggggcgtgcccggcgacctgtacctgttcgtcgtgacc
aacacccccgactccagcgacgcctcgaagaccacctacgacatgatgaaaggcctgggc
caggagcaactgatgccgcaggtacagcgcgacctggcgcatgacttgcgggaaaagcgg
gagcagttgaagcaggtcagggaaaacctacatcccgatccctatgtccggcgcggccag
gaaaacaacatcgaacggctggagcgcaagatcgaagcgctcgaacagaaaggcgtgacg
ccggaagtcgagcaacgcctcggcggactcggcgcgcaggagattcccggactggcgaag
aacaccggcgaggacgacaagccctatcaacttgccgaagtacccggcctcaaggtggtc
gtcgccaccctggccaccagcgaccctgcccccggcagcccgccgccagcgcgcctgtcc
gccgaagccgaggccgccctcggggcgccgccgctgaaggcgcgctacaagcacatctac
gtgcactccaagctgctgctggtggatgacctctataccctgctcagctcggccaatatc
aatgtccgcagcatgcatggcgacagcgagttggggattgcccagcccaatccggatttg
gcgagggcgatgcgggaggagttgtggggggcgcatgttgggaggttggccgaaacgacc
gaaaaaaacttcgaattgtggaatcagaagatggatgataactggaaggcccaggtggca
gatgagccttttacttcgcacttgctgcgcttctgggatgtcactacaccctatagtcaa
aatcttacggtggactga

DBGET integrated database retrieval system