KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2452Help
Entry
NCGM2_2452        CDS       T01974                                 

Gene name
ygdE
Definition
(GenBank) putative RNA 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pnc03009]
    NCGM2_2452 (ygdE)
Enzymes [BR:pnc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     NCGM2_2452 (ygdE)
Ribosome biogenesis [BR:pnc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    NCGM2_2452 (ygdE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: BAK89310
Position
1:2626695..2627753
Genome map
AA seq 352 aa AA seqDB search
MNTLLMHCRPGFEGEVCAEIAEHAATLEIPGYAKSKPASAHVEFVCQDADGAERLMRRLR
FADLIFPRQWARGPGFIELPESQRIEVLLAELASYPVCGSLWLEVLDTNAGKEVSTFCRK
FEKPLRAALVKAGRLQEDPALPRLLLTFRSGREVFVGLAEPRNSALWPMGIPRLKFPREA
PSRSTLKLEEAWHQFIPRSEWDKRLAPDMLAVDLGAAPGGWTWQLVNREMRVTAVDNGPM
AENLMYSGLVDHQKVDGYQYRPRQRVDWMVCDIVEKPARTGALIETWIGEGLCREAVVNL
KLPMKQRYAEVRKILQRLRESFDARGLKVAIGCKQLYHDREEVTCHLRRLER
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaataccctgttgatgcactgccggccaggcttcgaaggtgaagtctgcgccgaaatc
gccgagcatgcagccactctcgagattcccggctacgccaagagcaagccggccagcgcc
cacgtcgagttcgtctgccaggacgccgacggcgccgagcgcctgatgcgccgcctgcgt
ttcgccgacttgatcttcccgcgccagtgggcgcgcgggcccggcttcatcgaattgccg
gaaagccagcgcattgaggtactgctggcggaactggcgagttatccggtttgcggcagc
ctctggctggaggtgctggacaccaatgccggcaaggaggtctcgaccttctgccgcaag
ttcgagaaaccgctgcgcgccgcgctggtgaaggccgggcggttgcaggaggacccggcg
ctgccgcgcctgctgctgaccttccgctccggccgggaagtcttcgtcggcctcgccgag
ccgcgcaacagcgcgctctggccgatgggcatcccgcgcctgaagtttccccgcgaggcg
ccgagccgttcgacgctgaagctggaggaagcctggcaccagttcatcccgcgcagcgaa
tgggacaagcgcctggcgccggacatgctcgccgtggacctcggtgcggcgccgggcggc
tggacctggcaactggttaaccgggagatgcgggtgaccgccgtggacaacgggccgatg
gcggagaacctgatgtattccgggctggtcgaccaccagaaggtcgacggctaccagtac
cgcccgcgccagcgggtcgactggatggtctgcgacatcgtcgagaagccggcacgcacc
ggtgcgttgatcgagacctggatcggcgaagggctttgccgcgaggcggtggtcaacctc
aagctgccgatgaagcagcgctacgccgaggtgcgcaagatcctccagcgcctgcgcgag
agcttcgacgcgcgcggcctgaaggtagcgatcggctgcaagcagctgtatcacgaccgc
gaggaagtgacctgccatctacgccgcctcgaacgctga

DBGET integrated database retrieval system