KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2552
Entry
NCGM2_2552        CDS       T01974                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NCGM2_2552
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pnc02044]
    NCGM2_2552
Secretion system [BR:pnc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NCGM2_2552
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: BAK89410
Position
1:complement(2732174..2734210)
AA seq 678 aa
MFAAANQTHFSLAIDGLALDLQVLSFSGREAISQPFAFDLELVGERPVPDLESLLHKPAF
LTLGPAGNGIHGLVRSAGQGDSGKRLTRYRITLVPQLAYLAQRTNQRIFQHLTVPQIVGR
VLEEHGILADAYRFQLGTRYPEREYCVQYDESDLQFVQRLCCEEGIHFHFQHSATAHLLV
FGDDQTVFPRLAPVAYQQDSGLVADRPAVKRFGVRLETRTSRVTRRDYDFEKPRLTLESA
ARGEARPDLEDYDYPGRFVDRERGKHLARRALERQRSDYRLAEGRSDQPLLLSGHFLPLA
AHPQAGWNDLWLLTEVIHEGRQPQVLEESIVSDTSASPDDFRQGYRNRFQATPWEAFFRP
PPTPPKSRILGTQSAVVTGPKGEEIHCDRYGRVKVQFHWDREGQADDSSSCWLRVASGWA
GKNYGAIAIPRVGMEVLVTFLEGDPDQPLVTGCLFHREHPVPYELPAHKTRSVFKSLSSP
WRRWLQRAAHRGPQGPGADLRPCPARLGRKHRARPEDPRRSPTPRHREGEQLQRVQGRGT
PHHPRRAQGGGPRQRPPHRSQRPAPEDRQRPVCRGRPGDPPEQRPEGGAGGRRRTDPQGR
WQLPQARRQRRDPLRGQRPGQLRRQPGQRQRRGAAVAGAAAAGRQRQGRRPPHPGPDQYP
EAQRALLRRVREVQGRCL
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgttcgcagcagccaaccagacccacttcagcctcgccatcgacggcctcgccctcgac
ctgcaggtgctctccttcagcggccgcgaagccatcagccagccgttcgccttcgacctg
gagctggtcggcgaacgccccgtgccggacctcgaaagcctgctgcacaaacccgccttc
cttaccctcgggcccgccggcaacggtatccacggcctggtgcgcagcgccggacagggc
gactcgggcaagcgcctgacccgctaccgcatcaccctcgtcccgcaactggcctacctc
gcccaacgcaccaaccagcgcatcttccagcacctcacggtgccgcagatcgtcggccgg
gtgctggaggaacacggcatcctcgccgacgcctaccgcttccagctcggcacccgctac
cccgagcgcgaatactgcgtgcagtacgacgagagcgacctgcagttcgtccagcgcctg
tgctgcgaggagggcatccactttcatttccagcacagcgccacggcgcacctgctggtg
ttcggcgacgaccagacggtgttcccgcggctcgcgccggtggcctaccagcaggactcc
ggcctggtcgccgaccggccggcggtcaagcgcttcggcgtacgcctggaaacccgcacc
agccgcgtcacccgccgcgactacgacttcgagaaaccgcgcctgacgctggaaagcgcc
gcccgcggcgaagcccggccggacctcgaggactacgactatcccggtcgcttcgtcgac
cgcgagcgcggcaagcacctggccaggcgtgccctcgaacggcagcgcagcgactaccgc
ctggccgagggccgcagcgaccaaccgttgctgctcagcggccacttcctgccgctggcc
gcccatccccaggcgggctggaacgacctctggctgctcaccgaggtgattcacgagggg
cggcagccgcaggtgctggaagaaagcatcgtctccgacacctcggcgagcccggacgac
ttccggcagggttaccgcaaccgcttccaggccacgccctgggaggcgttcttccgtccc
ccgccgacgccgccaaagtcgcgcatcctcggcacgcagagcgcggtggtgaccggcccg
aagggcgaggaaatccactgcgaccgctacggtcgggtgaaggtgcaattccactgggat
cgcgagggccaggccgacgacagcagcagttgctggttacgcgttgcctccggctgggcg
ggaaagaactacggcgccatcgccatcccgcgggtcggcatggaggtgctggtgaccttc
ctcgaaggcgatcccgaccagccgctggtcaccggctgcctgttccacagggaacatccg
gtgccctacgaactgccggcgcacaagacccgcagcgtcttcaagagcctcagcagtccc
tggcggcggtggctacaacgagctgcgcatcgaggaccgcaagggccaggagcagatctt
cgtccatgcccagcgcgactgggacgaaaacatcgagcacgaccagaagatccgcgtcgg
tcaccaacgccacgacaccgtgaaggcgaacagctacagcgagttcaaggccgaggaaca
ccgcaccacccacgccgagcgcaaggtggaggtccgcgccagcgaccacctcaccgtagc
caacgaccagcacctgaagatcgccagcggccagtttgtcgaggccggccaggagatcca
cctgagcagcggcctgaaggtggtgctggaggccggcgccgaactgaccctcaagggcgg
tggcagcttcctcaagctcgacgccagcggcgtgaccctctccggggccaacgtccgggt
caactccggcggcagcccgggcagcggcagcggcgcggcgccgctgttgccggggccgct
gcggcaggccgacagcgacaaggccggcgccctcctcaccccggcccagatcaataccct
gaagcgcaacgcgcccttctgcgaagagtgcgagaagtgcaaggacggtgcctgtga

DBGET integrated database retrieval system