KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2555
Entry
NCGM2_2555        CDS       T01974                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    NCGM2_2555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pnc02044]
    NCGM2_2555
Secretion system [BR:pnc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NCGM2_2555
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: BAK89413
Position
1:2737214..2737720
AA seq 168 aa
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTQRGDERKVEDRKPIGIDKM
TFDEVLAKQELGLTLSVPNRLQEEGGSDELAVGLQINSMKDFNPASIVEQVPELKKLMEL
RDALVALKGPLGNAPAFRKAIESVLADDESRSRVLGELGLSAAPSQDA
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccaaagaaggctcggtagccccaaaggaacgcatcaacgtcactttcaagcccgcc
accggcggtgcccaggaagaaatcgaactgccgttgaagctactggcgatcggcgattac
acccagcgcggggatgagcgcaaggtggaggaccgcaagccgatcggcatcgacaagatg
accttcgacgaggtcctggccaagcaggagctagggctgacgctgagcgtacccaatcgt
ctccaggaggagggcggcagcgacgagctggcggtggggctgcagatcaactcgatgaag
gacttcaacccggccagcatcgtcgagcaggtgcccgagctgaagaagctgatggagttg
cgcgatgcgctggtggccctcaagggcccgctgggcaacgccccggcgttccgcaaggcc
atcgaaagcgtactcgccgacgacgagtcccgtagccgtgtgctgggcgagctggggctg
agcgccgccccctcccaggacgcctga

DBGET integrated database retrieval system