KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2558
Entry
NCGM2_2558        CDS       T01974                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pnc02044]
    NCGM2_2558
Secretion system [BR:pnc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NCGM2_2558
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: BAK89416
Position
1:2739975..2741762
AA seq 595 aa
MSFNHYYQSELTALRQLGRRFAERSPALAPFLGQVGRDPDVERLLEGFAFLTGRLRQKLD
DELPELSHSMMHLLWPNYMRPLPAFSILQFDPLTRPGGALRVERDTPVESRPVGEVACRF
RTCYATEVLPLVLEALNYSVTGEGALLGLRLAMNCDGHLGELGLSRLRLHLAGERYISQM
LYLCLLRNLESIQLIPLDAHGRPLDGVAGKPMSFRLTGERVQPVGFAEDEALIPYPLNTF
RGYRYLQEYFAFQDKFLFVDVDGLDLLGALPEETLKQVRGLELRFDIRKSGIQRLHPTLE
NVKLYCTPVANLFRHDALPIRLDGKQDEYLLMPAEYSLEDCGVFSVEGVTGWRPGGLGYQ
AYVPFESFEHDPSFDVPEARPHYSVRQRTSLLHDGLDTYLSFGIRHPEQIETLSVELTCT
NQNLPQRLRLGDICVACEGTPEFLGFRNITPATPSYAPPLNRDFLWKLISNMSLNYLSLA
NVDALKVILETYDLPRYYDQHAAKVSKRLLGGLKAVRHEHVDRLHRGLPLRGLRTELTID
PEGYIGEGDLFVFASVLNEFFALYASINSYHELRVRSTQGDVYQWKPRMGLQPLL
NT seq 1788 nt   +upstreamnt  +downstreamnt
gtgtccttcaatcattactaccagagcgaactcaccgcactgcgccagctggggcgccgt
ttcgccgagcgtagcccggccctggccccgtttctcgggcaggtcggacgcgatccggat
gtcgagcgcctgctcgagggctttgccttcctgaccgggcggttgcggcagaagctggac
gacgagttgccggaactcagccactcgatgatgcacctgctgtggccgaactatatgcgc
ccgctgccggctttcagcattctccagttcgaccccctgacccgcccgggcggggcgctg
cgcgtggagcgcgatacgccggtcgagagccggccggtgggcgaggtcgcctgtcgcttc
cgtacctgctacgccaccgaggtcctgccgctggtgctggaggcgctcaactattcggtg
accggcgaaggcgcgctgctcggcctgcgcctggcgatgaactgcgacgggcacctcggc
gagctgggcctgagtcggctgcgcctgcacctggccggcgagcgctacatcagccagatg
ctctacctgtgcctgctgcgcaacctggagagcatccagctgattccgctggacgcccat
gggcggccgctggatggcgtggccggcaagccgatgtcgttccgcctgacgggcgagcgg
gtgcagccggtgggtttcgccgaagacgaggcgttgattccctatccgctgaataccttc
cgtggctatcgctacctgcaggagtacttcgcgttccaggacaagttcctgttcgtcgac
gtggatggcctggacctgctcggcgcgctgcccgaggaaaccctcaagcaggtccgcggc
ctcgagttgcgcttcgatatccgcaagagcggcatccagcgcctgcacccgacgctggag
aacgtcaagctgtactgtacgccggtggccaacctgttccgccacgatgcgctgccgatc
cgcctcgacggcaagcaggacgagtacctgctgatgccggccgaatacagcctggaggac
tgcggggtgttctcggtagaaggcgtcactggctggcggccgggcgggctcggctaccag
gcttacgtaccgttcgagtccttcgagcacgatcccagcttcgacgttcccgaagcacgg
ccccactacagcgtccggcaacggacctcgttgctgcacgatggcctggacacctacctg
agcttcggcatccgccatcccgagcagatcgagacgctgtcggtggaactgacctgcacc
aaccagaacctgccccaacggctgcgcctgggcgatatctgcgtcgcctgcgaaggcacg
ccggagttcctcggtttccgcaatatcaccccggcgacgccgagctacgcgccgccgctg
aaccgcgatttcctctggaaactgatcagcaacatgtcgctcaactacctgtcgctggcc
aacgtcgacgcgctcaaggtgatcctcgaaacctacgacctgccgcgctactacgaccag
catgcggcgaaggtcagcaagcgcctgctgggcgggctcaaggcggtccgccacgagcat
gtcgaccgcctgcatcggggcctgccgctgcgcggcttgcgtaccgagctgacgatcgat
ccggaaggctacatcggcgagggcgacctgttcgtgttcgcttcggttctgaacgaattt
ttcgcgctttacgccagcatcaactcctaccacgagttgcgggtgaggagcacacaggga
gacgtgtaccaatggaaaccgcgcatgggtttgcagcccctgctgtaa

DBGET integrated database retrieval system