KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2568Help
Entry
NCGM2_2568        CDS       T01974                                 

Gene name
stp1
Definition
(GenBank) serine/threonine phosphoprotein phosphatase
  KO
K11915  serine/threonine protein phosphatase Stp1 [EC:3.1.3.16]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc02025  Biofilm formation - Pseudomonas aeruginosa
pnc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NCGM2_2568 (stp1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    NCGM2_2568 (stp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pnc02044]
    NCGM2_2568 (stp1)
Enzymes [BR:pnc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     NCGM2_2568 (stp1)
Secretion system [BR:pnc02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   NCGM2_2568 (stp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP2C_2 PP2C SpoIIE
Motif
Other DBs
NCBI-ProteinID: BAK89426
Position
1:2754590..2755318
Genome map
AA seq 242 aa AA seqDB search
MQRTEPWRSAARTDRGKVRARNEDAFLDCPDRGLWAVADGMGGHQAGDLASRMIVTSLAE
LPARAGFDERLNAMRQCLHWLNRRLGEELTLSAERGDRIIGSTVVALVVEGSRAACVWVG
DSRCYLWRGQRLYQLSRDHSLLQRLVDERRMDIEQARAYPSARALTRAVGASEQLVLDVL
ELEVHPGDVFLLCSDGLYEELSADALGRALSLASPQVAVERLFDGALSGAARDNLTAVVI
RQ
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcaccgagccctggcgcagcgcggcgcgcacggatcgcggcaaggtccgcgcg
cgcaacgaggatgccttcctggactgcccggatcgcgggctctgggcggtcgccgatggc
atgggcgggcaccaggccggcgacctggccagccggatgatcgtcaccagcctggcggaa
ctgccggcccgggcgggattcgacgagcgcctgaacgcgatgcgccagtgcctgcactgg
ctcaaccggcgcctgggcgaggaactcaccctcagcgccgaacgcggcgacaggatcatc
ggcagtacggtggtggcgctggtcgtggagggttcgcgggcggcctgcgtgtgggtcggc
gacagccgctgctacctgtggcgcggccagcggctgtaccagctgtcccgcgaccactcg
ctgttgcagcgactggtcgacgaacggcggatggatatcgaacaggcccgcgcctatccc
tcggcgcgcgcgctgacccgtgccgtcggcgccagcgaacaactggtgctggacgtgttg
gaactggaggtgcatcccggtgatgtcttcctgctctgcagcgacgggctctacgaagag
ctgagcgccgatgcgctgggccgcgcgttgagcctggcatcgccgcaggtggcggtggag
cggctgttcgacggcgctctgagcggcgccgcgcgggacaacctgacggccgtggtgatc
cgccaatga

DBGET integrated database retrieval system