KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_3379Help
Entry
NCGM2_3379        CDS       T01974                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pnc02044]
    NCGM2_3379
Secretion system [BR:pnc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NCGM2_3379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: BAK90227
Position
1:3616224..3618017
Genome map
AA seq 597 aa AA seqDB search
MSDSIDADLLDYYQRELTWLRHAGGAFAERYPKVARRLQLAPGECPDPHVERLLEGFSLL
TARLQRRLDDDYAEFSDALLEQLYPLALRPLPSCAIVQFEPDPTQGNLAEGYRLPRDTAL
FVTTRGGDSVHFRSSAEATLWPLAIDEATLLGGEEAQALTGVGAARSALRLSLRCLGEYR
WDELSIERLRIHLAASPMGCAILYDLLAAHAVQVMAGAPGTPPAALRGLPEIVGFAADEA
LLPEEDGGHPGLRLLAEYFAFPDKFHFFDLPLSGALADGQTLYLYLVFDRAPTARLHLQA
EDFQLGCAPAINLFPRTSEPLRPDGTRSEYRLVADSHRENSVEIHSIRAVRSVAGSTVQP
VPAYYGCRHDSHLGTLYWHARRIAGLTPNRLGSDLLLSLVDTGFDPLREAPAFSLTAELL
CTNRYLAERLGAGTALGFERPGPVAAARLRNAPSAQSQPRLDGQSRWRLVSQLTLNHLSL
VEGPRALEALREILALHNLRDDASARRQIEGLRQLDCQRVVAHVGEDAWRGWRNGLEIRL
RLDPQHFVGASGVLFSAVLAQFFSLYATANRFVRTVLVEADKEVKTWQPQAGSPLSL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattcgattgatgccgacctgctcgactactaccagcgcgagctgacctggctg
cggcatgccggcggcgccttcgccgagcgctatccgaaggtcgcccggcgcctgcaactg
gcccccggcgaatgccccgacccgcacgtcgagcgtctgctggaaggcttctcgctgctc
accgcgcgcctgcaacggcgcctcgacgacgactacgcagagttcagcgacgccctcctc
gaacagctctaccccctggcgctgcgcccgctgccgtcctgcgcgatcgtccagttcgaa
ccggacccgacccagggcaacctcgccgagggctaccggctgccgcgcgacaccgcgctg
ttcgtcaccacccgcggcggcgacagcgtgcatttccgcagcagcgccgaggcgactttg
tggccgctggcgatcgacgaggcgaccctgctcggcggcgaggaggcgcaagccctgacc
ggagtcggcgccgcccgctcggcgttgcgcctgagcctgcgctgcctgggcgagtaccgc
tgggacgaactgtcgatcgagcgcctgcgcatccacctggcggcttcgccgatgggctgc
gcgatcctctacgacctgctcgccgcgcatgccgtgcaggtcatggcgggggcgcccggc
acgccgccggcggcgctccgcggactgccggagatcgtcggcttcgccgccgacgaggcg
ctgctgccggaggaagacggcggacatccgggcctgcgcctgctcgccgagtacttcgcc
ttccccgacaagttccacttcttcgacctgccgctgtccggcgcgctcgccgacggacag
acgctctacctgtacctggtcttcgatcgcgcaccgacggcacgcctgcatttgcaggcg
gaagacttccagctcggctgcgcgccggcgatcaacctctttccgcggacctcggagccg
ctgcgcccggacggcacccgcagcgagtaccgcctggtcgccgacagtcaccgcgagaac
agcgtggaaatccatagcatccgcgccgtgcgctcggttgccgggagcaccgtgcagcca
gtcccggcctactatggctgccgccacgacagccacctcggcacgctctactggcacgcc
cggcgcatcgccgggctgaccccgaaccggctgggcagcgacctgctgctgagcctggtg
gataccggcttcgacccgttgcgcgaggccccggccttcagcctgaccgccgagctgcta
tgcaccaatcgctatctggccgagcgcctgggtgccggcaccgcgctgggcttcgaacgg
cccgggccggtcgccgccgcacgcctgcgcaacgcgcccagcgcgcagagccagccgcgc
ctggacggccagtcgcgctggagactggtctcgcagctgaccctcaaccacctctcgctg
gtggaaggtccgcgcgccctcgaagccttgcgggaaatcctcgccctgcacaacctgcgc
gacgacgccagcgcccgccggcagatagaaggcctgcggcaactcgactgccagcgggtg
gtggcgcacgtcggcgaggatgcctggcgcggctggcgcaatggcctggaaatccgcctg
cgactcgatccgcaacacttcgtcggcgccagcggcgtgctgttctccgccgtgctggcg
cagttcttctcgctgtatgccaccgccaaccgcttcgtgcgcacggtcctggtggaagcc
gacaaggaggtgaagacatggcaaccccaggccggctcgccgctctccctctga

DBGET integrated database retrieval system