KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_3381
Entry
NCGM2_3381        CDS       T01974                                 

Definition
(GenBank) putative ClpA/B-type protease
  KO
K11907  type VI secretion system protein VasG
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc02025  Biofilm formation - Pseudomonas aeruginosa
pnc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NCGM2_3381
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    NCGM2_3381
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pnc02044]
    NCGM2_3381
Secretion system [BR:pnc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NCGM2_3381
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 Clp_N AAA_16 AAA_22 ClpB_D2-small Sigma54_activat AAA_25 AAA_7 Zeta_toxin ResIII T2SSE AAA_14 NACHT FtsK_SpoIIIE AAA_23 AAA_28
Other DBs
NCBI-ProteinID: BAK90229
Position
1:3618999..3621548
AA seq 849 aa
MELAALIGRLNPDCRRALEHAAQRCLQRTHHYVEIEHLLLELLDIDGGDFACLLPRFGLE
RDALVAEINLSLELFKAGNTRTPALSAHTIGLLEDAVVHASVLGQAQIRSGLLLLALLDR
EERRALLLNSASSLLRIPHEALQANLLEWIQASREQPAAPNRPAAGGDKPESAPDPLLDQ
YTQDLTAEARAGRIDPIVGRDGEIRQCVDILLRRRQNNPILVGAPGVGKTAVVEGLALRI
AAGEVPPSLQEVILRVLDLGLLQAGASMKGEFEQRLKGVIDAVRNSAQPIILFIDEAHTL
IGAGGAEGGSDAANLLKPALARGELRTLAATTWLEYKKYFEKDPALTRRFQLVQVEEPDE
ATAVEMLRGIAGKLELHHGVQIMDAAIVDAVKLSHRYISGRQLPDKAISVLDTACARVAL
GQHDVPPPLESLRHREQALEEELQRLRREQATGLDHSARITALESESGDNRRTIRELETR
WDEEREAVRELLDTRRELLALSESADAAKPDEELDGRIDHLAAELARLAAGLEAIRQDDP
LVPEQVDSRTVAAVIAGWTGIPVGKMLADEAHAIRSLAQRMGQRVMGQEAALGAIAQRIQ
AYRAGLSDPAKPVGVFLLPGPTGVGKTETAYALADALYGGERNLISINLSEYQEAHTVSQ
LKGAPPGYVGYGSGGVLTEAVRRKPYSVVLLDEIEKAHPDVLEAFYNVFDKGVMEDGTGL
VVDFRNTVILATSNVGAELLLDSPAEQVATPAFDERLRKVLLQTFRPAFLARMTVVPYRP
LEEATLEGIVVAKLEKLRERYKAATGKQFDFDPAIVKAVLAKCSAAGARDIENVLMAQVT
GKLAEWVLE
NT seq 2550 nt   +upstreamnt  +downstreamnt
atggaactcgccgccctgatcggccgcctcaacccggactgtcgccgcgccctggagcac
gccgcgcaacgctgcctgcaacgcacccatcattacgtagagatcgagcacctgctgctg
gagctgctggacatcgacggcggcgacttcgcctgcctgctgccgcgcttcggcctggag
cgcgacgccctggtcgccgagatcaacctgtcgctggagctgttcaaggccggcaatacc
cgcactccggcgctgtccgcgcacaccatcggcctgctcgaggacgccgtggtccacgcc
agcgtgctcggccaggcgcagatccgttccggcctgctgctgctcgccctgctcgaccgc
gaggagcgccgcgccctgctgctgaacagcgcgtcgtcgctactgcggattccccacgag
gccttgcaggccaacctgctggagtggatccaggcctcccgcgaacagccggccgcgccg
aaccgcccggcggcaggcggcgacaagccggaaagcgccccggacccgctgctcgaccag
tacacccaggacctcaccgccgaagcccgcgccgggcgcatcgaccccatcgtcgggcgc
gacggggagatccgccagtgcgtcgacatcctcctgcgccggcggcagaacaacccgatc
ctggtcggcgcgccgggcgtcggcaagaccgcggtggtcgagggcctggccctgcgcatc
gccgccggcgaggtgccgccgtcgttgcaggaggtgatcctgcgggtgctcgatctcggc
ctgttgcaggccggcgccagcatgaagggcgagttcgagcagcgcctcaagggcgtgatc
gacgccgtgcgcaacagcgcgcagccgatcatcctgttcatcgacgaggcgcacacgctg
atcggcgccggcggcgcggaaggcggcagcgacgccgccaacctgctcaagccggccctg
gcgcgcggcgagttgcgcaccctggcggccaccacctggctggaatacaagaaatacttc
gagaaggacccggcgctgacccggcgcttccaactggtccaggtcgaggagccggacgag
gccaccgccgtggagatgctgcgcggcatcgccggcaagctggaactgcatcacggcgtg
cagatcatggacgcggccatcgtcgatgcggtgaagctgtcgcaccgctacatctccggc
cgccagttaccggacaaggcgatcagcgtgctcgacaccgcctgcgcgcgggtcgccctc
ggccagcacgacgtgccgccgccgctggaaagcctgcgccaccgcgagcaggcgctggaa
gaggaattgcagcggctgcgccgggaacaggccaccggcctcgaccacagcgcgcgtatc
accgccctggaaagcgagtcgggcgataaccgccggaccatccgcgagctggagacccgc
tgggacgaggaacgcgaagcggtgcgcgaactgctcgacacccgccgcgaattgctggcc
ctcagcgaaagcgccgacgcggccaagcccgacgaggaactggacggtcgcatcgaccac
ctggccgccgaactggcgcgcctggcggccggcctcgaagccatccgccaggacgacccg
ctggttcccgagcaggtggactcgcgtaccgtggccgcggtgatcgccggctggaccggc
atcccggtgggcaagatgctcgccgacgaagcccacgccatccgttccctggcgcaacga
atgggccagcgggtgatgggccaggaggccgccctgggcgccatcgcccagcgcatccag
gcctatcgcgccggactcagcgacccggccaagccggtcggcgtattcctcctgcccggc
cccaccggcgtgggcaagaccgagaccgcctacgccctggccgacgccctctacggcggc
gaacgcaacctgatcagcatcaacctctccgagtaccaggaggcccacaccgtcagccag
ctcaagggcgccccgcccggctacgtcggctacggcagcggcggcgtgctcaccgaagcg
gtgcgccgcaagccctattcggtggtgctgctggacgagatcgagaaagcccatccggac
gtgctggaagccttctacaacgtgttcgacaagggtgtgatggaagacggcaccggcctg
gtggtggacttcaggaacaccgtgatcctcgccaccagcaacgtcggcgccgaactgctg
ctggacagcccggccgaacaggtcgccaccccggccttcgacgagcgcctgcgcaaagtc
ttgctgcaaaccttccgcccggcgttcctcgcgcgcatgaccgtggtgccttaccggccg
ctggaggaagccaccctggaaggcatcgtcgtggccaagctggaaaaactgcgggaacgc
tacaaggccgctaccggcaaacagttcgacttcgacccggccatcgtcaaggccgtgctc
gccaagtgcagcgcggcgggcgcgcgggatatcgagaacgtgctgatggcgcaggtgacg
gggaagttggcggagtgggtactcgaatga

DBGET integrated database retrieval system