KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_3563Help
Entry
NCGM2_3563        CDS       T01974                                 

Definition
(GenBank) putative AMP-binding protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00010  Glycolysis / Gluconeogenesis
pnc00620  Pyruvate metabolism
pnc00640  Propanoate metabolism
pnc00680  Methane metabolism
pnc01100  Metabolic pathways
pnc01110  Biosynthesis of secondary metabolites
pnc01120  Microbial metabolism in diverse environments
pnc01130  Biosynthesis of antibiotics
pnc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCGM2_3563
   00620 Pyruvate metabolism
    NCGM2_3563
   00640 Propanoate metabolism
    NCGM2_3563
  Energy metabolism
   00680 Methane metabolism
    NCGM2_3563
Enzymes [BR:pnc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NCGM2_3563
Lipid biosynthesis proteins [BR:pnc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NCGM2_3563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAK90411
Position
1:complement(3892361..3894028)
Genome map
AA seq 555 aa AA seqDB search
MRDYATTAAGFDLQRTAAATLSGTLQALNACVECCDRHALPGRIALFWEGKDGSRASYTF
SELKALSGRFANFLQAQGVRPGDCVAGLLPRTPELLVTILGAWRLGAVYQPLFTAFGPKA
IEHRVATAGSKVLVTDAANRDKLDELADPPLAVTVGGPKGQGIRRGDFSFWAELERYPAE
FEPVPRSGEDPFLMMFTSGTTGLAKPVPVPLKAILAFVGYLREAVDLRPEDAFWNLADPG
WAYGLYYAVAGPLAMGHPTTFYEGPFSVESTCRIIRDYGITNLAGSPTAYRLLMAAGAAA
ETALKGRLRAVSSAGEPLTPEVIRWFADRLGTTIHDHYGQTELGMVLCNHHALAHPVRVG
AAGFACPGHRVVVLDDDLNELPPGQPGILALDRRRSPLMWFPGYQGLETAAFVGDYYLSG
DTVELNEDGSISFVGRADDVITTSGYRVGPFDVESALIEHPAVMEAAVIGKPDPERTELV
KAFVVLCAGHRPTPELADELQRYVRQRLSAHAYPREIEFLEELPKTPSGKIQRFLLRNQE
IARQREAAPQAAAAN
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactacgccaccaccgccgccgggttcgacttgcagcggaccgccgccgccacg
ctttccggcacgctccaggcgctcaacgcctgcgtcgaatgctgcgaccggcatgccctg
ccgggtcggatcgcgttgttctgggagggcaaggatggcagtcgcgccagctataccttc
agcgagctgaaagcgctctccggacgtttcgccaatttcctccaggcccagggcgtacgc
ccgggcgattgcgtcgccggcctgttgccgcgcacgcccgagctgctggtcaccatcctc
ggcgcctggcgcctgggcgcggtgtaccagccgctgttcaccgccttcggcccgaaggcc
atcgaacaccgcgtggcgaccgccggcagcaaggtgctggtcaccgatgcggccaaccgc
gacaagctcgacgaactcgccgatccgcctctggccgtcaccgtcggcggaccgaagggg
cagggcatccgtcgtggcgatttcagcttctgggccgagctggagcgctatccggctgaa
ttcgaaccggttccgcgcagcggcgaggatccgttcctgatgatgttcacctccggcacc
accggcctggccaaaccggtgccggtgccgctcaaggcgatcctcgccttcgtcggctac
ctgcgcgaggcggtggacctgcgccccgaggacgccttctggaacctcgccgatccgggc
tgggcctacggcctctactacgctgtcgccggtcccctcgccatgggccatccgaccacc
ttctacgaagggccgttcagcgtagaaagcacctgccggatcatccgtgactacggcatc
accaacctcgccggatcgcccaccgcctatcgcctgctgatggccgccggcgcggccgcg
gaaactgcgctgaaggggcgcctgcgcgcggtcagcagcgccggcgagccgttgacgccg
gaggtgatccgctggttcgccgataggctcggcaccaccatccacgaccattacgggcag
accgagctgggcatggtgctgtgcaaccaccatgccctggcgcatccggtgcgggtcggt
gccgccggattcgcctgtcccgggcaccgggtggtagtgctggacgacgatctcaacgaa
ctgccgcccggccagccgggcatcctcgccctcgaccggcggcgttcgccgctgatgtgg
ttccccggctaccagggcctggaaaccgcagccttcgtcggcgactactacctgagcggc
gataccgtcgaactcaacgaagacggcagcatcagcttcgtcggccgcgccgacgacgtc
attaccacctctggctaccgggtcggcccgttcgatgtggagagcgcgctgatcgaacac
ccggcagtgatggaggcggcggtgatcggcaagcccgacccggagcgcaccgaactggtc
aaggccttcgtcgtgctctgcgccggccaccggccgacgccggaactggcggacgaactg
cagcgatacgtgcgccagcgcctgtcggcgcacgcctacccgcgggagatcgagttcctc
gaggaactgccgaagacccccagcggcaagatccagcgctttctcctgcgcaaccaggag
atcgcccggcaacgcgaggcggccccacaggcggccgccgcgaactga

DBGET integrated database retrieval system