KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_3650Help
Entry
NCGM2_3650        CDS       T01974                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00630  Glyoxylate and dicarboxylate metabolism
pnc01100  Metabolic pathways
pnc01110  Biosynthesis of secondary metabolites
pnc01120  Microbial metabolism in diverse environments
pnc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NCGM2_3650 (aceA)
Enzymes [BR:pnc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NCGM2_3650 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: BAK90494
Position
1:3984537..3986132
Genome map
AA seq 531 aa AA seqDB search
MSAYQNEIKAVAALKEKNGSSWSAINPEYAARMRIQNRFKTGLDIAKYTAAIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSDFGPLPDQSM
HEKTAVSGLIEELYTFLRQADARELDLLFTGLDAARAAGDKAKEAELLAQIDNFETHVVP
IIADIDAGFGNAEATYLLAKKMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHIDFLAKI
NAVRYAFLELGVDDGVIVARTDSLGAGLTKQIAVTNEPGDLGDLYNSFLDCEEISEAELG
NGDVVIKREGKLLRPKRLASNLFQFRKGTGEDRCVLDCITSLQNGADLLWIETEKPHVGQ
IKAMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRNKLMSVEYD
DTELAKVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADEGMLAYVK
GVQRQELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatatcagaacgagatcaaggcagttgccgcgctgaaagagaagaacggcagc
agctggagcgcgatcaaccccgagtacgcagctcgcatgcgtatccagaaccgcttcaag
accggcctggatatcgccaagtacaccgcggccatcatgcgcaaggacatggccgaatac
gatgcggactcctccgtctacacccagtcgctgggttgctggcacggcttcatcgggcag
cagaagctgatctcgatcaagaagcacctgaagaccaccaacaagcgctacctctacctg
tccggttggatggtcgccgcgctgcgctccgacttcggcccgctaccggaccagtccatg
cacgagaaaaccgcggtttccggcctgatcgaagagctgtacaccttcctgcgccaggct
gacgcccgcgagctggacctgctgttcaccggcctggacgctgcccgcgccgctggcgac
aaggccaaggaagccgagctgctggcccagatcgacaacttcgaaacccacgtggtgccg
atcatcgccgacatcgacgccggcttcggcaacgccgaggcgacctacctgctggccaag
aagatgatcgaagccggcgcctgctgcatccagatcgaaaaccaggtgtccgacgagaag
cagtgcggccaccaggacggcaaggtcaccgttccgcacatcgacttcctcgccaagatc
aatgccgtacgctacgccttcctcgagctgggcgtggacgatggcgtgatcgtcgcccgt
accgactccctgggcgccggcctgaccaagcagatcgccgtgaccaacgagccgggcgac
ctgggcgacctgtacaactccttcctggattgcgaagagatctccgaggccgagctgggc
aacggcgacgtcgtgatcaagcgcgaaggcaagctgctgcgtccgaagcgcctggcttcc
aacctgttccagttccgcaagggcaccggcgaagatcgctgcgtcctggactgcatcacc
tcgctgcagaacggcgccgacctgctctggatcgaaaccgagaagccgcacgtcggccag
atcaaggcaatggtcgatcgcatccgcgaagtgattccgaacgccaagctggtctacaac
aacagcccgtccttcaactggaccctgaacttccgccagcaggtgttcgatgcgttcgtc
gccgaaggcaaggacgtttccgcctacgaccgcaacaagctgatgagcgtcgagtacgac
gacaccgagctggccaaggtcgccgacgagaagatccgcaccttccagcgcgatggctcg
gcccacgccggcatcttccaccacctgatcaccctgccgacctaccacaccgccgcgctg
tccaccgacaacctggccaagggctacttcgccgacgaaggcatgctggcctacgtgaag
ggcgtgcagcgccaggaactgcgccagggcatcgcctgcgtcaagcaccagaacatggcg
ggctccgacatcggcgacaaccataaagagtacttcgcaggcgaagccgctctgaaggcc
agcggcaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system