KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_3711
Entry
NCGM2_3711        CDS       T01974                                 

Gene name
rhs
Definition
(GenBank) hypothetical protein
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
SSDB
Motif
Pfam: RHS_repeat RHS
Other DBs
NCBI-ProteinID: BAK90555
Position
1:complement(4048405..4052358)
AA seq 1317 aa
MSGLPVSHVGEKVSGGVISTGSPTVHVGSSAVGLADRVSACVPLVGKPVNPMLGSKLLPE
EVDFALAAPDTFTFARGYLSSNPRIGRLGRGWWLPGESMHLELSEDACVLVDAQGRRIGF
PALAPGAQHYSGSEELWLRRGGSSGGEAQAWRGRWAAVPAELQTQEGSVLVLSGHSYLHF
QRCPDGIWRLQASFGRAGYRTEFRWSGRGLLTGVRDSAGRSYALVYQQACEPSEGDDGLR
LFGVILASHDGPPPDYIDPQSPGLDWLVRYQFSDSGDLIAVRDRLGQVVRVFAWREHMLV
AHGEPGGLEVRYEWDVHAPHGRVVKQIEAGGLTRTFRYLRDATEVSDSLGRVERYEFAGE
GGQRRWTALVRADGSRSEFDYDLFGRLVAMRDPLGRETRRRRDGQGRMLEEESPGKARYR
KRVDEETGLLVELEDAMQRRWTFERDERGNVTTVRGPAGSTRYAYEDPRLPDRPTRIVDP
RGGERRLEWNRFGLLAALTDCSGQVWRYDYDNEGRLVASSDPLGQLTRRRYDPLGQLIGL
ELADGSALSYEYDALGRQTRIADAEGHATLFSWGHGDLLARVSDAGGGELSYLHDEAGRL
VALTNENGVQAQFRYDLLDRLVEETGFDGRRQRYRYNAADELIAREDADGRETTYAYDRD
GRLASIRVPATEHAPALVERYRWLADGRLASAGGADCEVRYTYDEVGNLRLESQVHADGW
VYSVEHSHDALGVRQTSRYGDAPPVAWLTYGPGHLHGALVGAVELAFERDALHREVRRDA
RRDGQDDALFTQERQHAPLGRLQRSRLRLAGGFDWQRGYRYDGLGQLVGIDDNQYPSVRY
EYDLGGRLLASRRAGAAASTYRYDAAGNRLEGVGEYAREDARQAFAENELYRSGFSRSEA
RASQAGEGPARWAGNRVERIAGNRYRFDALGNLVERIGADGERLRLAYDGAQRLVHLTRD
YADGTRLEARYRYDALSRRIAKVVLRDGVEQQVRFGWDGDRQCAEAFARELRTTVHEPGG
FVPLLRLEQACEPDPPELLQLRQAFAAEGQPLPAQCVPALGEARIAFFHTDHLGTPLQLS
DERGQLRWQGVPDDWRAVAPERQPGAQPIRFQGQYHDEESGLYYNRYRYYLPEAGRYASQ
DPLGLGGGPNPYAYALNAPTLAYDPTGLIIPLVVIGAFAARAAIGAALGAGIELGMQTGK
QVLGQMKDNWDSDRDLTDIKWKCIDINWKHVGASAAIGTVAPGMLSTGKTVVQSAKAIRT
LSGQAANTANRAAKLAARKAAHADTIKKAVATQAAWQTGKQIVKCPLKDEEEECPPQ
NT seq 3954 nt   +upstreamnt  +downstreamnt
atgagcggcctaccggtttcccatgtcggcgagaaagtctcgggaggggtgatctccacc
ggctcgcccaccgtgcacgtcggcagcagcgcggtcggcctggccgaccgggtgtccgcc
tgcgtgccgttggtgggcaagccggtcaacccgatgctcggcagcaagctgctgccggaa
gaggtcgatttcgccctggcggcgccggacaccttcaccttcgcccgtggctacctgtcg
agcaacccccgtatcggccggctcggccggggctggtggctgccgggcgagagcatgcac
ctggaattgagcgaagacgcctgcgtgctggtcgacgcccagggccgccggatcggcttt
cctgcgctggctcccggcgcgcagcattattccggcagcgaggagctgtggctgcgccgc
ggcggttcgagcggcggcgaagcgcaggcctggcgcgggcgctgggcggcggtgccggcc
gaactgcagacgcaggagggctccgtgctggtgctgtccggccacagctacctgcatttc
cagcgttgccccgacggtatctggcgcctgcaggccagcttcggccgcgccggctaccgc
accgagttccgctggagcggacgtggcctgctcaccggcgtgcgcgacagcgccgggcgc
agctatgcgttggtctaccagcaggcctgcgagccgagcgagggcgacgacggcctgcgt
ctgttcggcgtgatcctggccagccacgacggaccgcctccggactacatcgatccgcag
agcccggggctcgactggctggtgcgctaccagttcagcgacagcggcgacctgatcgcc
gtgcgcgaccgcctcggccaggtggtccgggtattcgcctggcgcgagcacatgctggtc
gcccacggcgaaccgggcgggctggaggttcgctacgagtgggatgtccatgctccgcac
gggcgggtcgtgaagcagatcgaggcgggcggcctgacccgtaccttccgctacctgcgc
gatgccaccgaggtcagcgacagcctcggccgcgtcgaacgctacgagttcgccggcgag
ggtgggcagcggcgctggaccgcgctggtcagggccgacggcagccgtagcgagttcgac
tacgacctgttcggccgcctggtcgccatgcgcgacccgctggggcgggagacgcggcgc
cggcgcgatggccaggggcggatgctcgaggaggagtcgccgggcaaggcgcgctatcgc
aagcgcgtcgacgaagagaccgggctgctggtcgagctggaggacgcgatgcagcgccgc
tggaccttcgagcgcgacgaacggggcaatgtgacgacggtgcgcggcccggccggcagc
acccgctacgcctacgaagacccgcgcctgcccgaccggccgacgcgaatcgtcgacccg
cgcggcggcgagcggcgcctggagtggaaccgcttcggcctgttggccgcgttgaccgat
tgttccggccaggtctggcgttacgactacgacaacgaaggacgtttggtcgccagcagc
gacccgctgggacaactgacccggcgccgctacgacccgctggggcaactgatcggcctg
gaattggccgacggcagcgccctgagctatgaatacgacgcccttgggcggcagacccgt
atcgccgatgccgaagggcacgccacgctgttttcctgggggcacggcgatctgctggcg
cgggtttccgacgccggcggcggcgaattgtcctacctgcacgacgaagccggcaggctg
gtcgccctgaccaacgagaacggcgtccaggcgcagttccgctacgacctgctggaccgt
ctggtggaagagaccggcttcgacggtcgtcgccaacgctatcgctacaacgccgctgac
gaactgatcgcccgcgaggatgccgacggtcgcgagaccacctatgcctacgaccgcgac
ggccgcctggcgagcatccgggttcccgccaccgagcacgcaccggccctggtcgagcgt
taccgctggttggccgacggccgcctggccagcgccggcggggcggattgcgaggtgcgc
tacacgtacgacgaggtcggtaacctgcgcctggaaagccaggtacatgccgacggttgg
gtctacagcgtcgagcacagccacgacgcgctaggcgtgcgccagaccagccgctacggc
gacgcgccgccggtcgcctggctgacctatggcccgggtcatctgcacggcgcgctggtc
ggtgcggtcgagctggccttcgagcgcgatgccctgcaccgtgaggtgcgtcgcgacgcc
cgccgcgacgggcaggatgacgcgttgttcacccaggagcgccagcacgcgccgctggga
cgcctgcagcgcagccgcctgcgtctggccggcggtttcgactggcagcgcggctatcgc
tacgacggacttggacaactggtcggcatcgacgacaaccagtatccgtcggtgcgctac
gaatacgacctcggcggtcgcctgctggccagccggcgcgctggcgcggcggccagcacc
taccgctacgacgccgccggcaaccgcctggagggcgtcggcgagtacgcgcgcgaggac
gctcgccaggcattcgccgagaacgaactgtaccgctccggtttcagtcgctccgaggcg
cgcgcgagccaggccggcgaaggcccggcgcgctgggccggcaaccgcgtggagaggatc
gccggcaaccgctatcgcttcgatgcgctgggcaacctggtcgagcgtatcggcgccgac
ggcgagcgcctgcgcctggcctacgacggcgcgcagcgcctggtccatctgacgcgcgat
tacgccgacggcacgcggctggaggcgcgctaccgctacgacgcgctgtcgcgacggatc
gccaaggtggtgctgcgcgacggtgtcgagcagcaggtgcgcttcggttgggacggcgat
cgccaatgcgccgaagcctttgcgcgggaactgcgcaccaccgttcacgaaccgggcggt
ttcgtcccgttgctgcgcctggagcaggcctgtgagcccgatcccccggagctgctgcaa
ctgcgccaggcgttcgccgccgagggccagccgctgccggcgcaatgcgtgccggcgctg
ggcgaggcgcggatcgctttcttccacaccgaccacctcggtacccccctgcagctgagc
gacgaacgtggccaactgcgttggcagggcgttccggacgactggcgggcggtagcgccg
gaacgacagccgggtgcgcagccgatccgcttccaggggcagtaccacgatgaggaaagc
ggcctctactacaaccgctaccgttactacctgccggaagccgggcgctatgccagccag
gacccgctcggcctgggcggtggccccaacccctatgcctacgcgctgaacgcgcccacg
ctggcctacgatcccaccggcctgatcatcccgctggtggtgatcggcgccttcgccgcc
cgcgccgcgatcggagcggcgctgggcgccggcatcgagctggggatgcagaccggcaag
caggtgctggggcagatgaaggacaactgggacagcgatcgcgacctcaccgatatcaag
tggaagtgcatcgacatcaactggaaacacgtcggcgcctcggcggccatcggcaccgtg
gcgccgggcatgctcagcaccggcaagaccgtggtgcagtccgccaaggcgatcaggacc
ctttccggacaggcggccaacaccgccaaccgcgcggccaagctggccgcgcgcaaggcc
gcccatgccgataccatcaagaaggccgtggccacccaggccgcctggcagacgggcaag
cagatcgtcaaatgcccgctgaaggacgaagaagaggagtgcccgccgcaatga

DBGET integrated database retrieval system