KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4680Help
Entry
NCGM2_4680        CDS       T01974                                 

Gene name
fmt
Definition
(GenBank) bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00520  Amino sugar and nucleotide sugar metabolism
pnc01100  Metabolic pathways
pnc01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pnc_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NCGM2_4680 (fmt)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    NCGM2_4680 (fmt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pnc01005]
    NCGM2_4680 (fmt)
Enzymes [BR:pnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     NCGM2_4680 (fmt)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     NCGM2_4680 (fmt)
Lipopolysaccharide biosynthesis proteins [BR:pnc01005]
 Unusual sugar
  NCGM2_4680 (fmt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: BAK91503
Position
1:5046182..5048170
Genome map
AA seq 662 aa AA seqDB search
MTSKAVVFAYHDIGCTGIEALLNAGYEIAAVFTHADDPRENTFYASVARLCAERGIPLHA
PEDVNHPLWLERIRQLRPDFLFSFYYRRLLGAELLACAARGAYNLHGSLLPRYRGRAPAN
WVLVNGETQTGVTLHRMIERADAGPILAQQAVAIDPEDTALSLHGKLRKAAGALLRDSLP
LLALGVLPEVEQDESQASHFGRRTPADGLLDWHRPARQLYDLVRAVTQPYPGAFCQVGEQ
KLIVWSAEVVAGNHGREPGSVLSCDPLRIACGEDSLVLRFGQRGERGLYLAGTQLATELG
LVEGARLRGAASGPQRRTRVLILGVNGFIGNHLSERLLRDGRYEVHGMDIGSDAIERLKA
DPHFHFVEGDIGIHSEWLEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIVR
YCVKYGKRVVFPSTSEVYGMCQDPDFDEDRSNLVVGPINKQRWIYSVSKQLLDRVIWAYG
QQGLRFTLFRPFNWMGPRLDRLDSARIGSSRAITQLILHLVEGTPIRLVDGGAQKRCFTD
VDDGIEALARIIDNRDGRCDGQIVNIGNPDNEASIRQLGEELLRQFEAHPLRAQFPPFAG
FREVESRSFYGDGYQDVAHRKPSIDNARRLLDWQPTIELRETIGKTLDFFLHEALREREA
QA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgaaagccgtcgtcttcgcctaccacgacatcggttgcaccggtatcgaagcc
ctgctcaatgccggctacgagatcgccgccgtcttcacccatgccgacgacccacgggaa
aacaccttctacgcctcggtcgcacgcctctgtgccgagcgcggcattccgctgcacgcg
cccgaggacgtgaaccatccgctgtggctggagcgcatccgccaactgcgcccggacttc
ctgttctccttctactaccgccgcctgctcggcgccgagctgctcgcctgcgccgcacgc
ggcgcctacaacctgcacggttcgctgctgccgcgctaccgcggacgcgccccggcgaac
tgggtgctggtcaacggcgaaacgcagaccggggtgaccctgcatcgcatgatcgagcgc
gccgacgccgggccgatcctcgcccagcaggccgtcgccatcgaccccgaggacaccgcc
ctgagcctgcacggcaagctgcgcaaggccgccggcgccctgctgcgcgacagcctgccg
ctgctcgccctcggcgtgctgccggaagtcgagcaggacgagagccaggccagccacttc
ggccggcgcaccccggcggacggcctgctcgactggcacaggccggcacggcagttgtac
gacctggtgcgcgcggtgacccagccctaccctggcgccttctgccaggtcggcgaacag
aagctgatcgtctggagcgccgaggtggtcgccggcaaccacggtcgcgagccgggcagc
gtactgtcctgcgacccgctgcggatcgcctgcggcgaggactcgctggtgctgcgcttc
ggccagcgcggcgagcgcggcctgtacctggccggcacgcaactggccaccgagctgggc
ctggtcgagggcgcgcgcctgcgtggcgcggcgtccggcccgcagcgccgcacgcgggtg
ctgatcctcggggtcaacggcttcatcggcaaccacctgtccgaacgcctgctgcgcgac
gggcgctacgaggtccacggcatggacatcggctccgacgccatcgaacggctcaaggcc
gacccgcatttccacttcgtcgaaggcgacatcggcatccattcggagtggctcgaatac
catgtgaagaaatgcgacgtggtcctgccgctggtggccatcgccacgcccatcgagtac
acgcgcaacccgctgcgggtgttcgaactggacttcgaggaaaacctgcggatcgtccgc
tactgcgtgaaatacggcaaacgcgtggtgttcccttccacctccgaggtctacggcatg
tgccaggacccggacttcgacgaagaccgctcgaatctggtggtcgggccgatcaacaag
cagcgctggatctactcggtgtccaagcagttgctcgaccgggtgatctgggcctacggc
cagcagggcctgcgcttcaccctgttccgtccgttcaactggatgggcccgcgcctggac
cgcctggattcggcgcggatcggcagctcgcgggcgatcacccagctcatcctgcacctg
gtcgaaggcacgccgatccgcctggtcgacggcggcgcgcagaagcgctgcttcaccgac
gtcgacgacggcatcgaggccctcgcgcggatcatcgacaaccgcgacggccgctgcgac
gggcagatcgtcaacatcggcaacccggacaacgaggcgagcatccgccagctcggcgag
gaactgctgcgccagttcgaggcccacccgctgcgcgcgcagttcccgcccttcgccggc
ttccgcgaggtggagagccgcagcttctacggcgacggctaccaggacgtggcccaccgc
aagccgagcatcgacaacgcccggcgcctgctcgactggcagcccaccatcgaactgcgc
gagaccatcggcaagaccctcgacttcttcctccacgaagcgctccgcgagcgcgaggca
caggcgtga

DBGET integrated database retrieval system