KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_5119Help
Entry
NCGM2_5119        CDS       T01974                                 

Definition
(GenBank) putative acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00071  Fatty acid degradation
pnc00072  Synthesis and degradation of ketone bodies
pnc00280  Valine, leucine and isoleucine degradation
pnc00310  Lysine degradation
pnc00362  Benzoate degradation
pnc00380  Tryptophan metabolism
pnc00620  Pyruvate metabolism
pnc00630  Glyoxylate and dicarboxylate metabolism
pnc00640  Propanoate metabolism
pnc00650  Butanoate metabolism
pnc00900  Terpenoid backbone biosynthesis
pnc01100  Metabolic pathways
pnc01110  Biosynthesis of secondary metabolites
pnc01120  Microbial metabolism in diverse environments
pnc01130  Biosynthesis of antibiotics
pnc01200  Carbon metabolism
pnc01212  Fatty acid metabolism
pnc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCGM2_5119
   00630 Glyoxylate and dicarboxylate metabolism
    NCGM2_5119
   00640 Propanoate metabolism
    NCGM2_5119
   00650 Butanoate metabolism
    NCGM2_5119
  Lipid metabolism
   00071 Fatty acid degradation
    NCGM2_5119
   00072 Synthesis and degradation of ketone bodies
    NCGM2_5119
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCGM2_5119
   00310 Lysine degradation
    NCGM2_5119
   00380 Tryptophan metabolism
    NCGM2_5119
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NCGM2_5119
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NCGM2_5119
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NCGM2_5119
Enzymes [BR:pnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NCGM2_5119
Exosome [BR:pnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCGM2_5119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAK91940
Position
1:5497894..5499069
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAGARTPMGGFQGSLAGVSAVDLGAVVIREAVQRAGIAAEDVQEVIMGCVLPAG
LKQGPARQAALAAGLPAATGCTTINKLCGSGMKAVMLAHDLLKAGTNQVMVAGGMESMSN
APYVLEKARSGLRMGHGEIKDHMFLDGLEDARTGRLMGSFAQETADKYGVTREEMDAYAI
ESLKRAQAAIADGSLAAEIVPVTVTSRKGESVVKDDEQPLTANLEKIPSLRPAFRKDGTI
TAANASSISDGASALVLMTAEEAQRRGLKPLARIVGHATQSQDPSEFTLAPIGAMTNLFA
RTGWSKDDVDLFEINEAFAMVTMLAMREHGLDHAKVNVYGGACAQGHPVGSTGSRIILTL
INALRQKGGKRGVASLCIGGGEATAVAVELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatcgtcatcgtcgccggcgcccgtactcccatgggcggcttccagggcagc
ctggccggcgtttccgcggtcgacctgggtgccgtcgtgatccgcgaagcggtgcagcgc
gccggcatcgccgccgaggacgtacaggaagtgatcatgggttgcgtcctgcccgccggc
ctgaagcagggcccggcccgccaggccgcgctggcggccggcctgcccgccgccaccggc
tgcaccaccatcaacaagctgtgcggctcggggatgaaggcggtgatgctggcccacgac
ctgctcaaggctggcaccaaccaggtgatggtcgccggtggcatggaaagcatgtccaac
gcgccctatgtcctggagaaagcccgcagcggcctgcgcatgggccacggcgagatcaag
gaccacatgttcctcgacggcctggaggacgcccgtaccggccgtttgatgggttcgttc
gcccaggagaccgccgacaagtacggcgtgacccgcgaggagatggacgcctatgccatc
gaatcgctcaagcgcgcccaggccgccatcgccgatggctcgctggcggcggaaatcgtc
ccggtcaccgtcaccagccgcaagggcgagagcgtggtgaaggacgacgagcaaccgctg
accgccaacctggagaagatcccgagcctcaggccggcgttccgcaaggacggtaccatc
accgccgccaatgccagctcgatctccgacggcgcctccgcgctggtcctgatgaccgcc
gaggaagcccagcgccgtggcctgaagccgctggcgcgaatcgtcggccatgccacccag
agccaggacccgagcgagttcaccctggcgccgatcggcgcgatgaccaacctgttcgcc
aggaccggctggagcaaggacgacgtcgacctgttcgagatcaacgaagccttcgccatg
gtcaccatgctcgccatgcgcgaacacggcctcgatcatgccaaggtcaatgtctatggc
ggcgcctgcgcccagggccatccggtcggctccaccggctcgcggatcatcctcaccctg
atcaacgccctgcgccagaaaggcggcaagcgcggcgtcgcctcgctgtgcatcggcggc
ggcgaagccaccgccgtggcggtcgaactgctctga

DBGET integrated database retrieval system