KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_6030
Entry
NCGM2_6030        CDS       T01974                                 

Gene name
hcpD
Definition
(GenBank) secreted protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc02025  Biofilm formation - Pseudomonas aeruginosa
pnc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pnc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NCGM2_6030 (hcpD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    NCGM2_6030 (hcpD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pnc02044]
    NCGM2_6030 (hcpD)
Secretion system [BR:pnc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NCGM2_6030 (hcpD)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: BAK92840
Structure
PDB: 
3HE1

Position
1:complement(6424591..6425109)
AA seq 172 aa
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPT
GQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAII
VDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcaacacccgcctatatgtccatcaccggcaccaagcagggcctgatcaccgccggc
gccttcaccgaggattcggtcggcaacacctaccaggaaggccacgaggaccaggtgatg
gtccagggcttcaaccacgaagtgatcatcccgcgcgatccgcagtccggccagccgacc
ggccagcgcgtgcacaagccggtggtcatcaccaaggtcttcgacaaggcctcgccgctg
ctgctggccgccctgacctccggcgagcgcctgaccaaggtcgagatccagtggtaccgc
acctccgccgccggcacccaggagcactactacaccaccgtcctggaagacgcgatcatc
gtcgacatcaaggactacatgcacaactgccaggacccgggcaacgcccacttcacccac
ctggaagacgtgcacttcacctaccgcaagatcacctggacccacgaagtctccggcacc
tccggctccgacgactggcgctccccggtcgccggctga

DBGET integrated database retrieval system