KEGG   Polynucleobacter necessarius: Pnec_0055Help
Entry
Pnec_0055         CDS       T00683                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pne  Polynucleobacter necessarius
Pathway
pne03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pne00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Pnec_0055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pne03011]
    Pnec_0055
Ribosome [BR:pne03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Pnec_0055
  Bacteria
    Pnec_0055
  Archaea
    Pnec_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4145
Motif
Other DBs
NCBI-ProteinID: ACB43383
UniProt: B1XSQ6
Position
60774..61109
Genome map
AA seq 111 aa AA seqDB search
MMMEVKAIHKGARISAQKTRLVADQIRGLPIARALNILNFSPKKAAFIVKKVVESAVANA
EHNKGADIDELKVSAIIVDKGTSLKRFTARAKGRGNQIEKQTCHISVTLSN
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggaagtcaaagctattcacaagggtgcccgcatttctgcgcaaaagactcgt
ttggtcgccgaccaaattcgtggtttgccgattgctcgcgcattaaacattttgaacttc
agccccaaaaaagctgccttcattgtgaaaaaagttgttgagtccgcagtggccaacgct
gaacacaataaaggcgctgacattgatgagctcaaggtttcagcaattattgttgataaa
ggtacttcattgaagcgctttactgcacgcgccaagggtcgtggcaatcaaattgaaaaa
caaacatgtcacattagcgtgaccttgagtaactaa

DBGET integrated database retrieval system