KEGG   Polynucleobacter necessarius: Pnec_0133Help
Entry
Pnec_0133         CDS       T00683                                 

Definition
(GenBank) 2-alkenal reductase
  KO
K04772  serine protease DegQ [EC:3.4.21.-]
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pne01002]
    Pnec_0133
Enzymes [BR:pne01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Pnec_0133
Peptidases [BR:pne01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Pnec_0133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 Trypsin PDZ_2 PDZ PDZ_6 Peptidase_S46 Tricorn_PDZ
Motif
Other DBs
NCBI-ProteinID: ACB43444
UniProt: B1XSW7
Position
complement(116354..117532)
Genome map
AA seq 392 aa AA seqDB search
MLNRLWLLFAQSVTILMAAWFIVATLKPSWLSNTQMGSMVESVTLREGAYDSTAISPGSY
HEAVKKSMPAVVNIFTSKANATPKTHKGNGGNSSDPLFKFFFGDQPPDAEPSSSLGSGVI
VSPEGIILTNHHVISDADEIDVALADGRKVKVKIIGSDPETDIAVLKIDAKQLPTPITLG
KIESIHVGDVVLAIGNPFGVGQTVTSGIISALGRDHVGINTFENFIQTDAAINPGNSGGA
LVDTRGHLIGINTAIYSNNGGSMGIGFAIPVNLAKQVMESILSNGSVTRGWIGVEPQNLS
KELSESLGLPKNTAGVLLSGVLEGGPAARGGIKPGDVLVAVNGNSTKDVRELLNQIAQIS
PGNEATLKILRKDKELELKVQTGKRPKPKTIN
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatcgactctggttactatttgcgcaatcagtaaccattcttatggctgcatgg
tttattgttgccacgctgaaacctagctggctatccaatacacaaatgggttcgatggtg
gagagcgttactctcagagagggtgcttacgacagcactgcaattagtccgggttcgtat
catgaggccgtcaaaaaatcaatgcccgctgtagtcaatatttttacaagcaaagcaaat
gcaacacccaagactcacaaaggtaacggtggtaattcatcagatcccttatttaaattc
ttttttggcgatcagcccccagacgcagaacccagctccagcctgggatctggtgtaata
gtcagccccgaaggaatcattcttaccaatcatcacgttatcagcgatgcagatgaaatt
gatgtagcgctagccgacggtagaaaagtaaaagtgaagatcattggcagcgacccggaa
actgacattgccgttttaaagattgatgctaagcaattaccaacacccatcacactcgga
aaaattgaatcgatccatgttggagatgttgtgctcgccattggaaatccatttggagta
ggacaaacggttacctcgggaattatttctgccttaggtcgcgatcatgtgggcattaat
acttttgaaaactttattcaaactgatgctgcaattaatccaggaaattctggtggtgcg
ctggtagatactcgcggacatctaattggaattaatactgccatttattccaataacgga
ggatccatggggattggtttcgccatccccgttaatcttgcaaaacaagtgatggaatcc
atcttgagcaatggcagcgtgacgcgtggctggattggggttgaaccccaaaacctctct
aaggagctctcagaatctttaggactgcctaaaaacacggctggcgtccttttatcaggg
gtcttagagggtgggcctgcagcgaggggcggcattaagcctggagatgtgctggtcgca
gtcaacggcaatagcaccaaggacgtcagagagctactcaatcaaattgcgcaaattagc
ccaggcaacgaagctacgctcaaaatcttacgcaaagataaagaattagagctgaaagtt
caaactggcaaaagacctaaacccaaaaccatcaattaa

DBGET integrated database retrieval system