KEGG   Polynucleobacter necessarius: Pnec_0166Help
Entry
Pnec_0166         CDS       T00683                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00071  Fatty acid degradation
pne00280  Valine, leucine and isoleucine degradation
pne00281  Geraniol degradation
pne00310  Lysine degradation
pne00360  Phenylalanine metabolism
pne00362  Benzoate degradation
pne00380  Tryptophan metabolism
pne00410  beta-Alanine metabolism
pne00640  Propanoate metabolism
pne00650  Butanoate metabolism
pne00903  Limonene and pinene degradation
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01120  Microbial metabolism in diverse environments
pne01130  Biosynthesis of antibiotics
pne01212  Fatty acid metabolism
Module
pne_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pnec_0166
   00650 Butanoate metabolism
    Pnec_0166
  Lipid metabolism
   00071 Fatty acid degradation
    Pnec_0166
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pnec_0166
   00310 Lysine degradation
    Pnec_0166
   00360 Phenylalanine metabolism
    Pnec_0166
   00380 Tryptophan metabolism
    Pnec_0166
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pnec_0166
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pnec_0166
   00281 Geraniol degradation
    Pnec_0166
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pnec_0166
   00627 Aminobenzoate degradation
    Pnec_0166
   00930 Caprolactam degradation
    Pnec_0166
Enzymes [BR:pne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pnec_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ACB43475
UniProt: B1XSZ8
Position
145485..146234
Genome map
AA seq 249 aa AA seqDB search
MDGKVATITLNRPEVLNALNDQLMEELGAALLAFDADDNIGCVIVTGSEKAFAVGADIAS
MAKYGLKDVYRGDFITRNWEEIKKVRKPVIAAVSGYALGGGCELAMMCDTIMAADNAKFA
QPEVKLGIIPGARGTQRLPRAVSKAKAMDLALTRRMMDAAEAERSGLVARIFPQADLLKE
VKVIAKGIADMPLLTAMMVKESINTAYETTLSEGIYFERRLFHACFGMNDQKEGMAAFME
KRPAKFANS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtggatggcaaggtcgccaccatcactttgaatcgccctgaagtattaaatgcattgaac
gatcaattgatggaagagcttggagctgcgctattggcttttgatgcagatgacaacatt
ggctgcgtgatcgtcaccggtagtgaaaaagcatttgcagttggtgctgatatagcttca
atggcgaaatatggattgaaggatgtttatcgaggcgactttattactcgcaattgggaa
gagattaaaaaagttcgcaagccagtgattgctgcagtctccggctacgcgcttggtggg
ggctgtgagttggccatgatgtgtgataccatcatggcagctgataatgcaaaatttgca
caacctgaagtgaagctgggcatcattcctggtgcacgcggtacacaacgtttaccgcgt
gcggtatcaaaggcaaaagccatggatctggctttgacaaggcgcatgatggatgccgcc
gaggctgagcgctccggtttggttgcaagaattttcccgcaagctgacttgctgaaagag
gtaaaagtgattgccaagggtattgcggatatgcctctgttgacggcaatgatggtgaaa
gaaagcatcaacactgcttatgagacaactctgtctgaaggcatttattttgaacgccgt
ctctttcatgcttgctttggaatgaatgatcagaaagaaggtatggctgcgttcatggaa
aaacgcccagccaagtttgcaaattcttaa

DBGET integrated database retrieval system