KEGG   Polynucleobacter necessarius: Pnec_0168Help
Entry
Pnec_0168         CDS       T00683                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00780  Biotin metabolism
pne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Pnec_0168
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pne01007]
    Pnec_0168
Enzymes [BR:pne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Pnec_0168
Amino acid related enzymes [BR:pne01007]
 Aminotransferase (transaminase)
  Class II
   Pnec_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACB43476
UniProt: B1XSZ9
Position
complement(146945..148180)
Genome map
AA seq 411 aa AA seqDB search
MTNLFNALHLAQEQIADLESQLLKRKLRATTSPCDTKVLVDGRELKAFCSNDYLGLANHP
DLVKALAKGGQKYGVGSGASHLISDHSMAHEVLEQKLAAFQKRHIPNARALFFSTGYLAN
LTAITALARLAPQGCTSIYSAKLNHASLIDGIRLAAAQTKANVALFDHTQAGVLNELLKA
DQKPLKIIVTDGVFSMDGDLTPIQKLLEIAEQNNALLLVDNAHGFGVLGSRGHGILESEN
ICSYRIVYIGTLGKAAGVGGAFICAQETLIEWLIQKGRPFIYSTATPPAIAHTLSKSLEI
IEGDEGISRRAQLNKLIRIWHDEMHFSQWEKVPSCTAIQPVILGSNANALLAAKLLDEAG
YWIPAIRPPTVPNGSARLRITFSAKHSEADLCQLIMTLQKIEKAVIEGTHD
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttatttaatgccctccatttagcgcaagagcaaatcgcagatcttgagtcc
cagctgctcaagcgaaaactcagagcaaccacatcaccatgcgacaccaaagtattagtt
gatggacgagagctaaaagcattttgtagcaatgactacctagggctggcaaatcatccc
gatttagttaaagcgcttgcaaagggcggccaaaaatacggggttggcagcggagcatct
catctcattagcgatcatagcatggctcatgaggtgctggagcaaaaattagcggccttt
cagaagcggcatattccgaatgcgcgcgcactattttttagcacgggctatcttgccaat
ctcacagccattacggctctagcaagacttgccccccaaggatgcactagcatttattcg
gcaaagttaaaccatgcatccttaattgatggtattcgtttagcagctgcacaaaccaag
gcaaacgttgccttgtttgaccatacacaagcaggcgtattaaacgaattactaaaagca
gatcagaaaccgctcaagattattgtgactgatggcgtctttagcatggatggcgatctg
acaccgattcaaaaattgttagaaattgcagagcaaaataatgctttactgttagtagat
aatgcacatggctttggagttttaggatctcggggtcatggcatcttagagtcagaaaat
atctgttcctatcgcattgtttatatcggcacccttggaaaagccgccggcgtcggtggt
gctttcatatgcgcacaagaaactttgattgaatggctgattcaaaaaggacgtccattt
atttacagtacagcaaccccaccagcaatagcgcacaccctttcaaaaagcttggaaatc
attgagggtgatgagggaattagtcgacgtgctcaactcaataaactcattcgtatttgg
catgatgaaatgcatttttctcaatgggaaaaagttccttcttgcaccgccatccaacca
gtcattttaggtagtaatgccaatgctttactagccgccaagttgctggatgaagcaggg
tattggattccagccattcgaccacccaccgttcccaatggcagtgcgagattgcgcatt
accttttccgcgaaacatagtgaagcagatttatgtcaactcatcatgacactgcaaaaa
attgaaaaggcagttattgagggaactcatgactaa

DBGET integrated database retrieval system