KEGG   Polynucleobacter necessarius: Pnec_0444Help
Entry
Pnec_0444         CDS       T00683                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00220  Arginine biosynthesis
pne00250  Alanine, aspartate and glutamate metabolism
pne00290  Valine, leucine and isoleucine biosynthesis
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01130  Biosynthesis of antibiotics
pne01210  2-Oxocarboxylic acid metabolism
pne01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pnec_0444
   00290 Valine, leucine and isoleucine biosynthesis
    Pnec_0444
   00220 Arginine biosynthesis
    Pnec_0444
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pne01007]
    Pnec_0444
Enzymes [BR:pne01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Pnec_0444
    2.6.1.66  valine---pyruvate transaminase
     Pnec_0444
Amino acid related enzymes [BR:pne01007]
 Aminotransferase (transaminase)
  Class I
   Pnec_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACB43716
UniProt: B1XTN9
Position
395434..396321
Genome map
AA seq 295 aa AA seqDB search
MPTPDYPLWTAAVSLSSGTPVHYLCDESKYWAPDLNDLRKKITPRTKAIVVINPNNLTGA
IYSKEVLLELTNIAREHGLILFADEIYDKMLYGGEKHISLASLSTDVVTITFNGLSKNYR
SCGYRAGWMIVSGDKEMVRDYIEGLNMLASMRLCANVPGQYAIQTALGGYQSINDLVGEG
GRLAKQRDLAWKLITDIPGVTCVKPKSALYLFPRLDPEVYPIEDDQQFVADLLKEEKVLL
VQGSGFNWGKPDHFRVVFLPHEDVLKEAIGRLARFLERYRNKHSRKASSTAAKAS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgccaacaccggactatccgctatggactgctgcggtgagtttgtcgagcggtactcct
gtccactatctttgtgacgaatccaaatattgggctccagatttaaacgatctacgtaaa
aaaattacgccacgtactaaagcgattgtggtgattaatccaaataatctgactggcgca
atttattcaaaagaagtattgcttgagttaacaaatattgctcgtgaacatggcttgatt
ttgtttgccgatgagatctacgacaaaatgttgtatggcggtgagaagcatatctcactc
gcatctctatcaacagatgttgtcaccattacctttaatggcttatccaaaaattaccgt
tcatgcggctaccgtgctggttggatgattgtttctggtgataaagaaatggttcgcgat
tatatcgaaggcttaaatatgttggcctcgatgcgcctgtgtgcaaacgtgccaggtcaa
tacgcgattcaaactgcattgggcggttatcagagtattaatgacttagtgggtgaaggt
ggtcgtctcgcaaagcagcgtgacctagcctggaaactcattaccgatattcctggcgta
acttgtgtgaaacccaagtctgctttgtatttgtttccaaggttagacccagaggtttat
ccaattgaagatgatcaacaatttgttgctgatctcttgaaggaagaaaaagtattgtta
gtgcagggctccggttttaattggggcaagcctgatcacttccgcgtagtgttcttgcct
cacgaagatgtgttgaaggaggctattggccgccttgcacgttttctggagcgttatcgt
aataagcacagccgtaaggcttcttcaactgcagcaaaggcatcatga

DBGET integrated database retrieval system