KEGG   Polynucleobacter necessarius: Pnec_0447Help
Entry
Pnec_0447         CDS       T00683                                 

Definition
(GenBank) MoeA domain protein domain I and II
  KO
K03750  molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00790  Folate biosynthesis
pne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pnec_0447
Enzymes [BR:pne01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     Pnec_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoeA_N MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: ACB43719
UniProt: B1XTP2
Position
399107..399751
Genome map
AA seq 214 aa AA seqDB search
MTKPPMLTAQQALDHLFSHAVAVSESEKVVMQAALGRVLAENVSSLVDVPPLDNTSMDGY
AVCCADILTPGRVLRVAQRIPAGAVVMQEDCAAEGLSDQVTINIAPTSGQWVRRKGEDLT
AGKTCLTAGTFLHPQELGVAASAGLTHLNVKRRIKVAAFFTGDELALPGEPLKPGGIYNS
NRDTLLACLKSLGCDATDLGIVPDRLEATREALR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgactaagccaccaatgttgactgcgcagcaggccttagaccatttgttctctcatgcg
gttgcagtaagcgagagcgagaaggttgtcatgcaagcggctttgggtcgcgttcttgct
gagaatgtcagtagtctggtcgatgttccgccattggataacacttccatggatggttat
gccgtttgttgcgctgacatattgacgccaggacgagtgctcagagttgctcaacgtatt
cccgctggtgcggtagtcatgcaagaggattgtgcagcagagggtctatctgatcaggta
acgattaatattgcgccgacatcgggccaatgggtgcgtcgcaagggtgaggatttaact
gctggaaagacatgcttaaccgctggaacatttttacatcctcaagagttgggtgtggct
gcctcagctggcctaacgcatttaaatgtaaaacgtcgcatcaaggtggcggcatttttt
actggtgatgagctcgcgcttccgggcgagccattaaagccaggtggaatctataactca
aatcgcgataccttattggcctgtcttaaatcattgggttgtgatgcaactgatttgggc
attgttcctgatcgcctggaggcaactcgagaagcgctgcgctaa

DBGET integrated database retrieval system