KEGG   Polynucleobacter necessarius: Pnec_0452Help
Entry
Pnec_0452         CDS       T00683                                 

Definition
(GenBank) Excinuclease ABC C subunit domain protein
  KO
K07461  putative endonuclease
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Pnec_0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIY-YIG GRIN_C Type2_restr_D3
Motif
Other DBs
NCBI-ProteinID: ACB43722
UniProt: B1XTP5
Position
complement(402377..402631)
Genome map
AA seq 84 aa AA seqDB search
MTWLVYLLECADGSYYAGITNHLEHRIEAHNSGQGARYTRSRRPVILLATQEHPDRSEAS
KAEAKLKRLPRAEKLAFFKDKNHP
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
ttgacctggcttgtttaccttcttgaatgcgctgatggctcgtattatgccggcattaca
aaccacttagaacatcgcattgaagcccataattcaggacaaggtgcacgttatacgaga
tcacgcagaccagtcatcctcttggcaacccaagagcatccggatagatcggaagcctca
aaagcagaggcaaaactaaagcgacttccaagagcggaaaaattggcattctttaaagac
aaaaaccacccatga

DBGET integrated database retrieval system