KEGG   Polynucleobacter necessarius: Pnec_0463Help
Entry
Pnec_0463         CDS       T00683                                 

Definition
(GenBank) endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
pne  Polynucleobacter necessarius
Pathway
pne03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pne00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Pnec_0463
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pne03400]
    Pnec_0463
Enzymes [BR:pne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Pnec_0463
DNA repair and recombination proteins [BR:pne03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Pnec_0463
 Prokaryotic Type
     Pnec_0463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S HHH_5 HHH_8
Motif
Other DBs
NCBI-ProteinID: ACB43730
UniProt: B1XTQ3
Position
complement(411083..411763)
Genome map
AA seq 226 aa AA seqDB search
MMNLEKRRAFFEQLKANNPKPETELEYSSPFELLIAVLLSAQATDVSVNKGTRKLYKVAN
TPQALLDLGEEGVRPYIQHIGLFNSKGKHIQESCRLLLDKHGGEVPQTREELEALPGVGR
KTANVILNTAFGQPTIAVDTHIFRVSNRTDLAPGKDVVKVEEQLLKRVPKEYLHNAHHWL
ILHGRYTCKARNPDCAQCIVEPLCGFKQKNWQRKSPWRYLIQHVKK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatctagaaaagcgacgtgctttttttgagcaactcaaagcaaataatcccaag
ccagaaactgagttggaatatagctcgccgtttgagttgttaattgcagtattgctatct
gcacaggcaacggatgtatcagtcaataaaggcactcgcaaactttacaaggtagccaat
accccgcaagcccttttagatttgggcgaagaaggagttaggccctacattcagcatatt
ggtttatttaactccaagggaaaacatattcaagagagctgtcgactgctcttggacaag
catggtggtgaagtacctcagactcgcgaggaattagaggctcttccaggtgttggcaga
aaaactgcgaatgtcattctcaataccgcttttggccaaccaactatcgccgttgatact
cacatattcagagtatccaaccgaacagatttggcgcccggcaaagatgtcgtgaaagta
gaggagcaactactcaagcgcgtaccaaaagagtatctgcataatgcccatcattggctt
attctgcatggaagatatacctgtaaagcacgcaatccagattgcgcacaatgcatagta
gaaccgctatgcggcttcaaacaaaaaaactggcaaaggaaaagtccgtggcgatattta
atccaacacgtgaagaagtga

DBGET integrated database retrieval system