KEGG   Polynucleobacter necessarius: Pnec_0464Help
Entry
Pnec_0464         CDS       T00683                                 

Definition
(GenBank) electron transport complex, RnfABCDGE type, B subunit
  KO
K03616  electron transport complex protein RnfB
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 FeS Fer4 Fer4_7 Fer4_10 Fer4_9 Fer4_2 Fer4_6 Fer4_16 CwsA Fer4_8 Fer4_22 Fer4_3 Fer4_13 Fer4_17 Fer4_4
Motif
Other DBs
NCBI-ProteinID: ACB43731
UniProt: B1XTQ4
Position
complement(411760..412446)
Genome map
AA seq 228 aa AA seqDB search
MSQTNTLIDQLEDILPQTQCTKCGYPDCRGYAEAMASGEALPNRCPPGGVEGIRRLSRVL
IPLYPQDAFDLNRAIDPECGLERPRAVAFIDPKKCIGCTLCIQACPVDAIVGASKQMHVV
LSDWCTGCNLCIPPCPVDCISMIDVTGGQTGWDAWSQDLADFARKRYHNREKRLDRERQD
NDDRLAKKAAAKLRTVDSEIPQSDKELKEQERKRAIIAAAIARAQQKK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacaaataccctcatcgatcaacttgaggatattcttccgcaaacacaatgt
actaaatgcggctacccagattgccgcggttatgcagaagcaatggctagtggagaggcc
ctgcctaatcgttgcccacctggtggcgtagaaggcattcggcgtctgagcagggtttta
attcccctatacccccaagacgcatttgatttgaaccgagcaattgatcctgaatgcggc
ctagaaaggcctagagcggttgccttcattgaccccaaaaagtgtattggttgcacctta
tgcatccaagcctgtcctgtagatgcaattgttggcgcctccaaacaaatgcacgtagta
ctgagtgactggtgcaccggttgcaacctctgcattccaccatgccccgtagattgcatc
agcatgatcgatgtcaccggcgggcaaactggttgggacgcctggtcacaagatcttgct
gatttcgcccgcaagcgctatcacaaccgtgagaaacgtcttgatagagagcgacaggat
aatgatgaccgtctcgctaaaaaggctgccgctaaattaaggacggttgatagcgaaata
ccgcaatcagacaaagaattaaaagaacaagagcgcaaacgcgccatcattgcagctgca
attgcccgtgcccaacaaaagaaatga

DBGET integrated database retrieval system