KEGG   Polynucleobacter necessarius: Pnec_0468Help
Entry
Pnec_0468         CDS       T00683                                 

Definition
(GenBank) transcriptional regulator, BadM/Rrf2 family
  KO
K13643  Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pne03000]
    Pnec_0468
Transcription factors [BR:pne03000]
 Prokaryotic Type
  Helix-turn-helix
   Rrf2 family
    Pnec_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rrf2 HrcA_DNA-bdg DNase-RNase
Motif
Other DBs
NCBI-ProteinID: ACB43735
UniProt: B1XTQ8
Position
417464..418033
Genome map
AA seq 189 aa AA seqDB search
MRLTTKGRFAVTAMIDLALREAHGPVTLAGISQRQKISLSYLEQLFGKLRRFNIVESTRG
PGGGYTLARPSSEVSVADIIVAVDESLDATQCGGKGNCHTDEENHGRCMTHDLWSNLNSK
MVEYLSSVSLKDLVQQQEGRGVVIQDMRQKKIKVESSKADKPAPALVAKKEVVPKAPLVN
SVFNLARQS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagacttacaactaaaggtcgttttgcagtaaccgcaatgattgatttagctctgcgt
gaagcgcatggccccgtaactttggctggaattagccaaagacaaaaaatttctctttct
tatctcgagcaattgtttggcaaactacgccgcttcaatatcgtagagagcactcgtggt
cctggcggtggttataccctggcgcgaccttcctctgaggtgagtgttgctgacatcatt
gttgcagtcgatgaatcgctcgacgcaacccaatgcggcggcaagggcaattgtcatact
gatgaagaaaatcatggccgttgtatgacgcatgatctttggagcaacctcaactctaag
atggttgagtacctcagctcggtaagcttaaaagatttggtgcaacaacaagaaggacgc
ggcgttgtcattcaagatatgcgccaaaagaaaattaaggttgaaagttctaaagcggat
aagcctgctcctgcgcttgtagctaaaaaagaagttgtccccaaagcaccattggtgaat
tccgtattcaacttggcacgtcagagttaa

DBGET integrated database retrieval system