KEGG   Polynucleobacter necessarius: Pnec_0470Help
Entry
Pnec_0470         CDS       T00683                                 

Definition
(GenBank) FeS cluster assembly scaffold IscU
  KO
K04488  nitrogen fixation protein NifU and related proteins
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Pnec_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NifU_N
Motif
Other DBs
NCBI-ProteinID: ACB43737
UniProt: B1XTR0
Position
419351..419737
Genome map
AA seq 128 aa AA seqDB search
MAYSEKVIDHYENPRNVGSFEKGDDSVGTGMVGAPACGDVMKLQIRVNDQGVIEDAKFKT
YGCGSAIASSSLVTEWVKGKTLDQAFEIKNSLIAEELALPPVKIHCSILAEDAIKAAVAD
YKEKHPAK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcatatagtgaaaaggtgattgaccactacgaaaacccccgtaacgttggttcattc
gaaaagggtgacgacagtgtgggtacaggcatggttggcgccccggcttgcggcgatgtc
atgaagctgcagattcgtgtgaacgatcaaggcgttattgaagatgcgaagttcaagact
tacggctgcggctctgcgattgcttcatcttcactggtaaccgagtgggttaaggggaaa
acattggatcaagcgttcgagattaaaaactcattgattgctgaagagttggctttgccg
ccagtaaaaattcactgctccatcttggctgaagatgccatcaaggcggcggtagcggat
tacaaagaaaaacatccagcaaaataa

DBGET integrated database retrieval system