KEGG   Polynucleobacter necessarius: Pnec_0471Help
Entry
Pnec_0471         CDS       T00683                                 

Definition
(GenBank) iron-sulfur cluster assembly protein IscA
  KO
K13628  iron-sulfur cluster assembly protein
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pne03016]
    Pnec_0471
Transfer RNA biogenesis [BR:pne03016]
 Prokaryotic Type
  tRNA modification factors
   Thiolation factors
    Pnec_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-S_biosyn
Motif
Other DBs
NCBI-ProteinID: ACB43738
UniProt: B1XTR1
Position
419759..420082
Genome map
AA seq 107 aa AA seqDB search
MAITLTDKAAAHVNRNLEKRGKGCGLRLGVRTTGCSGLAYQLEYVDEPAAEDQVFESNGI
KVFVDPKSLAYLDGTELDFVREGLNEGFKFQNPNVKDECGCGESFRV
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaccttaactgataaagcagccgcgcacgtaaaccgcaatttagaaaagcgc
ggcaaaggttgtggcttgcgtttgggcgttcgcactacaggctgttctggtttggcatat
cagctcgagtatgttgacgaaccagctgctgaagaccaggtatttgagtccaatggcatt
aaggtcttcgtagatccgaaaagcttggcttacttggacggtacagagttagattttgta
cgtgagggtttgaatgaaggatttaagtttcaaaatccaaacgtaaaggatgagtgtggt
tgtggcgaatccttccgcgtctga

DBGET integrated database retrieval system