KEGG   Polynucleobacter necessarius: Pnec_0477Help
Entry
Pnec_0477         CDS       T00683                                 

Definition
(GenBank) Phosphoadenylyl-sulfate reductase (thioredoxin)
  KO
K00390  phosphoadenosine phosphosulfate reductase [EC:1.8.4.8 1.8.4.10]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00920  Sulfur metabolism
pne01100  Metabolic pathways
pne01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Pnec_0477
Enzymes [BR:pne01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.8  phosphoadenylyl-sulfate reductase (thioredoxin)
     Pnec_0477
    1.8.4.10  adenylyl-sulfate reductase (thioredoxin)
     Pnec_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: ACB43743
UniProt: B1XTR6
Position
complement(424717..425295)
Genome map
AA seq 192 aa AA seqDB search
MVITDAINKAKAKIKLFTLATGRLHQETVDMIKTTEDRYGVSIEKIYPKEDNVQAFIYQY
GMNGFYDGEDPKKACCGARKIKPLNAALLGADAWITGQRREQSTTRTELNLEELDDARGI
AKFNPLFDWSEADIWAYIKQENVPIHPLHLKGYPSIGCEPCTRQVKKGEDIRASRWWWLQ
SDSKECGLHVNK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggtgattaccgatgcaattaacaaagcgaaagccaaaatcaagttatttactttagct
actggtcgccttcaccaagaaaccgtagacatgattaagacaactgaagatcgctatggc
gtgtcaattgaaaagatttatcccaaagaagataacgtacaagcctttatctatcaatat
ggcatgaatggcttttacgatggtgaagatcccaagaaggcatgctgtggcgcacgcaag
ataaaacctctgaatgcggcattacttggagcggacgcctggatcaccggccaacgacgc
gagcagtcaaccactcgtactgaactcaatttagaagagcttgatgatgctcgaggcatc
gcaaagttcaatcctttgtttgattggagtgaagcggatatttgggcctatatcaagcaa
gaaaacgttcctattcacccactgcacctaaagggctaccccagcattggttgcgaaccc
tgcacccgtcaagtgaagaaaggggaagatattcgcgcaagtcgatggtggtggctacaa
agcgacagcaaagaatgtggcttacacgttaataaataa

DBGET integrated database retrieval system