KEGG   Polynucleobacter necessarius: Pnec_0484Help
Entry
Pnec_0484         CDS       T00683                                 

Definition
(GenBank) cysteine synthase A
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00270  Cysteine and methionine metabolism
pne00920  Sulfur metabolism
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01120  Microbial metabolism in diverse environments
pne01130  Biosynthesis of antibiotics
pne01200  Carbon metabolism
pne01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Pnec_0484
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pnec_0484
Enzymes [BR:pne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Pnec_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF2188 PRMT5
Motif
Other DBs
NCBI-ProteinID: ACB43750
UniProt: B1XTS3
Position
428062..429036
Genome map
AA seq 324 aa AA seqDB search
MTYFTDNSQTIGKTPLVRLNRVTDGAKATVLAKIEGRNPAYSVKCRIGVAMINDAQEKGL
LGPGKEIVEPTGGNTGIALAFVAAARGIPLTLTMPETMSVERRKLLTALGAKIVLTEGPR
GMNDAVAKAKEIAESDSAKHVLLQQFSNPSNPAIHEKTTGPEIWEDTEGKIDVFVAGVGT
GGIISGVGRYIKNVQKKNIEVVAVEPTSSPVITQKLNGEEIKPAPHKIQGIGAGFIPDNL
DLSIVDKVEQISNEEAIEFARRIAKEEGILVGISYGAAAAVAVRLAKKPEYVGKTIVVAL
PDAAERYLSSALFEGVFDERGLPA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacttactttactgacaactcgcaaactattggtaaaacacctttagttcgtttaaat
cgcgtaactgatggtgctaaagcaactgtgctggcgaagattgagggtcgcaatccggcc
tattcggttaaatgtcgtattggtgttgcaatgattaatgatgctcaagaaaaaggtctt
ctaggtcctggtaaggaaatcgtggaacctactggcggcaataccggtatcgctttggct
tttgtagcggctgctcgcggtataccgctgacgcttaccatgccggagactatgagtgtt
gagcgtcgcaagttgcttactgcattaggtgccaagattgtcttgactgagggtcctagg
ggtatgaatgacgctgttgctaaagccaaagaaattgctgagtctgattctgctaaacat
gtgttactccaacaatttagcaacccatctaatcctgcaatccatgaaaaaactactggc
ccagaaatctgggaagacaccgaaggcaagatcgatgtatttgttgctggcgtaggaact
ggtggaataatctctggtgttggacgttacattaagaatgttcagaaaaagaatattgaa
gtggttgcggttgaaccaactagtagtcctgtaattacccagaagctaaatggcgaagag
atcaagccggctccacataagattcaaggtattggcgctggatttattccggataatttg
gatttatcgatagttgataaggtggagcagatttccaatgaagaggctatcgagtttgcc
cgccgtatcgccaaggaggaaggtattttggtgggtatttcctatggtgcggctgcggct
gtagcggtgcgccttgccaagaagcctgaatatgttggcaaaactatcgtggtagctctg
ccggatgccgctgagcgttacttaagctctgccttattcgaaggcgtgtttgatgagaga
ggcttgccagcttaa

DBGET integrated database retrieval system