KEGG   Polynucleobacter necessarius: Pnec_0490Help
Entry
Pnec_0490         CDS       T00683                                 

Definition
(GenBank) ABC transporter related
  KO
K09810  lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-]
Organism
pne  Polynucleobacter necessarius
Pathway
pne02010  ABC transporters
Module
pne_M00255  Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:pne00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Pnec_0490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pne02000]
    Pnec_0490
Enzymes [BR:pne01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Pnec_0490
Transporters [BR:pne02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    Pnec_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N DUF87 FtsK_SpoIIIE RsgA_GTPase ArgK AAA_33 AAA_22 AAA_30 G-alpha MMR_HSR1 AAA_24
Motif
Other DBs
NCBI-ProteinID: ACB43756
UniProt: B1XTS9
Position
435847..436572
Genome map
AA seq 241 aa AA seqDB search
MNNLVLKARDLAKTYGQGPTAVEVLKAIDLDVAPSEKLAIVGSSGSGKSTLLHLLGGLDT
PSSGSVILVGSILNNLSVRKLDQLRNHSLGFIYQFHHLLDEFSAAENVALPLRIRGLSND
ESMDRASKMLKAVGLSARELHTPGELSGGERQRVAVARALVGNPTCVLADEPTGNLDTET
ADGVFDLMLNIARDQGTAFVIVTHDPVRAKRCDRILHLERGVLKTFSACVDIPCGSIPIA
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaataacttagtgctcaaagccagagaccttgcaaaaacgtatggtcagggtcctaca
gcggttgaggttctcaaagcaattgatttggatgtggcgccctcagaaaagcttgctatt
gttggctcttcaggttctggcaaaagcactttgctgcacctcttgggcggtttagatact
ccaagttctggttcggtaattttggtcggctctattttgaataacttatcagtgaggaaa
ttagatcagctacgcaatcatagtttgggtttcatttaccagttccatcacctcttagat
gaatttagcgctgccgagaatgttgcgctaccgctgcgtattcgtggtttaagtaatgat
gagtctatggatcgcgccagtaagatgctgaaagcggttgggctatcagctcgagagcta
catactcctggcgagctgtcgggcggagagcgtcaacgtgttgctgttgctcgtgccttg
gtcggtaatcccacttgcgttttggcggatgagccaaccggtaatcttgatactgagact
gctgatggcgtatttgatttgatgttaaatattgctcgcgatcaaggtactgcgtttgtg
attgtgactcatgatcctgtgcgcgctaaacgttgtgatcgcattttgcatttagagcgt
ggagtattgaaaacattttcagcgtgtgtggacatcccatgtggatcgatacccattgcc
atctag

DBGET integrated database retrieval system