KEGG   Polynucleobacter necessarius: Pnec_0494Help
Entry
Pnec_0494         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly-zipper_YMGG DUF3482 DUF456 Gly-zipper_Omp
Motif
Other DBs
NCBI-ProteinID: ACB43759
UniProt: B1XTT2
Position
439688..440059
Genome map
AA seq 123 aa AA seqDB search
MNKLLVLSSIVVAIAVGCAGANVRPLVDMKSVNESAYEKDLSECQAYAQQQSGMGEKAAK
GAGAGAVVGGLLGLVTGGNKTGIVQAAGAGAVIGAAGGAFTGDQAQEAVVKRCLSGRGYK
VLN
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaataagctactcgtcttatcttctatagttgttgctatagcggttggctgtgccggc
gcgaatgttcgtcccctcgtggatatgaagagtgtaaatgaaagtgcatatgaaaaagat
ctaagtgaatgtcaggcttatgcgcaacagcaatcaggtatgggtgaaaaagctgcaaaa
ggagctggtgctggcgcagttgttggtggcttattgggtcttgttactggcggcaataaa
accggcattgttcaggctgccggagcgggagctgttataggtgctgcgggaggtgctttt
acaggcgaccaggcgcaagaggcggttgttaagagatgtttgagtggacgcggttacaag
gtactgaactaa

DBGET integrated database retrieval system