KEGG   Polynucleobacter necessarius: Pnec_0497Help
Entry
Pnec_0497         CDS       T00683                                 

Definition
(GenBank) DNA repair protein RadA
  KO
K04485  DNA repair protein RadA/Sms
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pne03400]
    Pnec_0497
DNA repair and recombination proteins [BR:pne03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Pnec_0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATPase AAA_25 ChlI AAA_16 DnaB_C Lon_C Rad51 AAA_24 RecA AAA_22 NTPase_1 AAA_30 AAA GvpD AAA_5 Zeta_toxin DAP3 DUF2075 NACHT AAA_29
Motif
Other DBs
NCBI-ProteinID: ACB43761
UniProt: B1XTT4
Position
442974..444242
Genome map
AA seq 422 aa AA seqDB search
MEEGLLETTSNSRFQGLAQSLPRQKLSAIAAEDLPRFSTGVEEFDRVLGGGLVPGGAVLL
GGDPGIGKSTLLLQALAEMSAAGMNVLYSSGEESAAQIALRAKRIALDAPQLEVLAEIRL
EKLISIMDTVKPQVLVVDSIQTLYSEVLSSAPGSVAQVRECAAQLTRAAKSSGICVLMVG
HVTKDGHLAGPRVLEHIVDTVLYFEGDTHSSFRLVRSIKNRFGAVNELGVFAMTEKGLRG
VTNPSAIFLSQHEQMVPGACVLVTQEGSRPLLVEIQALVDTAHVPNPRRLAVGLEQARLA
MLLAVLHRHAGVACFDQDVFLNAVGGVKISEPAADLAILLAIQSSIRNRALPKELIVFGE
VGLAGEIRPCPRGQERLKEAVKLGFTLAIIPKANMPKTKIPGVKVIPVERIDQAIAAAAE
LS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggtcttctggaaacaacttccaattctcgttttcagggtttggcgcaatcg
ttgccaagacaaaagctctctgctattgctgcggaagatttaccaaggtttagtacgggt
gtagaggagtttgatcgcgtgctgggtggtggcttagttccgggcggagcagtgctctta
ggtggtgaccccggtattggtaaatcaactttgctattgcaagcacttgcagagatgagt
gctgccgggatgaatgtgctttatagcagcggcgaagaatcggctgcccagattgcattg
cgtgcgaagcgcattgcattagatgccccccaactagaagtgttggctgaaattcggtta
gagaaactgatttcaattatggacaccgttaagccacaagtattagtggtggattccatt
cagaccttgtattcagaggttttaagttcagccccaggctctgttgctcaagtacgcgag
tgcgctgcgcaattaacgagagctgctaaatcaagtggcatctgcgtgctgatggtaggg
catgtgaccaaggatggtcatctggctggtcctagagtgttagagcatattgttgatacc
gttttgtatttcgaaggcgatacccattcttctttccgcttagtgcgatccatcaagaat
cgctttggcgctgtcaatgagcttggtgtattcgctatgacagaaaaaggtttgcgggga
gtaaccaacccttcggcgattttcttgtcgcaacacgaacaaatggttcctggtgcctgt
gtattggttacgcaagaaggcagcagacctttgttggtggagattcaggctctggtggat
accgcgcatgtgcccaatcctcgccgcttagcagttggcttggaacaagctcgtttggca
atgctcttggcggtgttgcatcgtcacgctggtgttgcctgttttgatcaagatgttttc
ttaaatgcagttggtggcgtaaagatatccgagccggctgctgacttagctatattgctc
gccattcaatcttctattcggaatcgcgccttgcctaaagagttaatcgtatttggtgaa
gttggtttggctggagagattcgtccttgtccacgcggtcaggagcgcttgaaagaagct
gttaaattgggctttactctagccatcattccaaaagccaatatgcctaagactaagatt
ccaggggtgaaggtaattccagtggagcgaattgatcaggcaatcgcggcggctgcagag
ttaagttaa

DBGET integrated database retrieval system