KEGG   Polynucleobacter necessarius: Pnec_0498Help
Entry
Pnec_0498         CDS       T00683                                 

Definition
(GenBank) protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific
  KO
K07320  ribosomal protein L3 glutamine methyltransferase [EC:2.1.1.298]
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pne03009]
    Pnec_0498
Enzymes [BR:pne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.298  ribosomal protein L3 N5-glutamine methyltransferase
     Pnec_0498
Ribosome biogenesis [BR:pne03009]
 Prokaryotic Type
  ribosomal protein modification factors
   Pnec_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 Methyltransf_25 Cons_hypoth95 Methyltransf_18 Methyltransf_15 PrmA Methyltransf_12 Methyltransf_10 UPF0020 Ubie_methyltran Methyltransf_11 Methyltransf_4 PHM7_ext
Motif
Other DBs
NCBI-ProteinID: ACB43762
UniProt: B1XTT5
Position
complement(444267..445163)
Genome map
AA seq 298 aa AA seqDB search
MDPESQQHLTANQCIDQIAQKLEATNLHYGHGAVDAQSEALWIVSKQLDLSPAEALDHLD
EAITAVQQQTASTVADTRISTRKPLAYILGEAWLMGVPFFCSEQSIVPRSWIAELIVDGS
LESWLPADGKALDLCTGNGSLAILLALSCPDIHVSACDISMPALSVAARNLDRHGLNTQV
ELLDGDLWDALPKPNEDNLFNLIICNPPYVNANSMNALPAEYHAEPALALAGGGDGMDLI
RRILAQAPDYLSERGAILLEIGNEYENFKKAFPQIPAIWMKVSAGDEQVLLIQAEDLR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggaccctgagtctcagcaacaccttaccgcaaatcagtgcatcgatcagattgcgcaa
aaactcgaagcgacgaacttacattacggccatggggcagttgatgcgcaaagcgaagcc
ttatggattgtaagcaaacaacttgatctcagtccagcagaagcgcttgatcatcttgat
gaagcaattactgctgtgcaacaacaaacagcctctactgttgctgacactagaatctcg
acacgcaaaccacttgcctacatcttgggtgaagcgtggctgatgggcgtgccattcttt
tgtagcgaacaaagtattgtgccgcgctcctggattgcagaactaatcgtggacggatcc
ttagagtcttggttgcccgcagacggtaaagcgcttgatctctgcacgggcaatggctcg
cttgcgatccttttggctttgtcatgcccagatatacatgtaagcgcttgcgatatcagc
atgcccgcactctcagtagcagcgcgtaacctagatcgccacggactaaatactcaagta
gagctattagatggtgacctatgggatgcactaccgaaacccaatgaagacaatttgttt
aatctcattatttgcaatccaccttatgtaaacgcaaactccatgaatgcacttcccgct
gagtatcatgccgagccagcacttgctttagctggtggtggtgatggcatggatttaatt
agacggattcttgctcaagcaccagattacctatctgagcgcggcgccatcttgcttgag
attggcaacgagtatgagaactttaaaaaggccttcccgcaaattccggccatctggatg
aaagtgtctgcaggtgatgagcaagtcttgctgattcaagcagaagacttgcgttaa

DBGET integrated database retrieval system