KEGG   Polynucleobacter necessarius: Pnec_0499Help
Entry
Pnec_0499         CDS       T00683                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00300  Lysine biosynthesis
pne01100  Metabolic pathways
pne01120  Microbial metabolism in diverse environments
pne01230  Biosynthesis of amino acids
Module
pne_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Pnec_0499
Enzymes [BR:pne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Pnec_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACB43763
UniProt: B1XTT6
Position
complement(445200..446351)
Genome map
AA seq 383 aa AA seqDB search
MSATLKLTEALIACHSVTPADGGCQDLIAKRLQAIGFHAESVVSGPENFQVTNLWAIKKG
KAGDQGKVLMFAGHTDVVPTGPLEKWTSDPFTPTIRDGMLYGRGAADMKTSLASFVVATE
EFVTTHPDHQGSIAFLITSDEEGPANDGTVIMCERLQKHGQRLDYCVIGEPTSVNTLGDM
IKNGRRGSLSGKLRVKGIQAHIAYPHLGQNPIHLSAPAISALVETQWDKGNEYFQPTSFQ
ISNVHAGTGANNVIPGKLVVDFNFRFSTESKPEQLRERLEKILKDAGLEFEIDWVLGGSP
FITGDGDLAGALRKAIKAETKIDTELSTTGGTSDGRFIAKICKEVVEFGPLNATSHKIDE
CVIVDDVVPLKNIYRKTLEQLIA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccacacttaagcttaccgaagctctcatcgcctgccattccgtaacaccggct
gatggtggctgccaagatttaattgccaagcgtctacaagcaatcggctttcatgctgaa
agtgttgttagtggccctgaaaattttcaggtaacgaatttgtgggcaatcaaaaaaggt
aaagctggcgatcaaggcaaagttttaatgtttgccggccataccgacgtagttcctact
ggcccactggagaagtggaccagcgatcctttcacacctacgattcgcgatggcatgctc
tatggccgtggcgcagcggatatgaaaacttcactcgctagttttgtagtggctacagaa
gaatttgtcacaacccacccagaccaccaaggctctattgccttcttaattaccagcgat
gaagaaggtccagccaacgatggcactgtcatcatgtgcgagcgcctgcaaaagcatggt
caacgcttggactactgcgtgatcggtgaacccacctcagtaaatacacttggtgatatg
attaaaaacggtcgtcgcggctccctatcaggtaagctcagagtaaaggggattcaagca
catattgcctaccctcacttgggccaaaatcctattcacctttctgctccagctatttct
gcattggtagaaactcagtgggataaaggtaatgagtactttcagccaaccagttttcag
atttcaaatgtacatgccggcactggcgccaataatgtcatccccggcaaactcgtggtc
gactttaatttccgcttctcaactgagagtaaaccagagcaattacgtgaacgtcttgaa
aagattctgaaagatgcaggtcttgaatttgagattgactgggtattaggtggcagtcct
tttattaccggtgatggcgacttggctggcgccctgcgcaaagccatcaaagcagaaacc
aaaatcgatacagaactctccacaactggcggcacgagcgatggtcgctttattgccaag
atctgcaaagaagttgtggagtttggccctctgaatgccacaagccacaagatcgacgaa
tgcgttatcgttgatgatgtagtgccactcaaaaatatctatcgcaagactctcgaacag
ttaatcgcttaa

DBGET integrated database retrieval system