KEGG   Polynucleobacter necessarius: Pnec_0510Help
Entry
Pnec_0510         CDS       T00683                                 

Definition
(GenBank) ribosome recycling factor
  KO
K02838  ribosome recycling factor
Organism
pne  Polynucleobacter necessarius
Brite
Translation factors [BR:pne03012]
 Eukaryotic Type
  Release factors
   Pnec_0510
 Prokaryotic Type
   Pnec_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RRF DUF5401 DUF883
Motif
Other DBs
NCBI-ProteinID: ACB43773
UniProt: B1XTU6
Position
460744..461304
Genome map
AA seq 186 aa AA seqDB search
MSAAEIKTNANQKMEKSLEALKTNLVKVRSGRANPGILEHIHVDYYGNPTPLSQVASLGL
ADARTINVQPFEKTMVAAIEKAIRDSDLGLNPVSQGTVIRVPMPALTEERRRELTKVVKS
EGEDAKIAVRNLRRDANEHLKRLTKDKEISEDDERRATDDIQKMTDKAVIDIDKIIAEKE
KEIMTV
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagcagaaattaaaactaatgccaatcaaaagatggaaaagtctctcgaggct
ttgaaaacgaatttagtcaaagttcgttctggtcgtgctaacccaggaatcttagagcac
attcatgttgattactacggtaatccaactccattgagtcaagtagctagcctaggtttg
gctgatgctcgcacgatcaatgttcagccatttgaaaagaccatggttgcggctattgag
aaggcgattcgtgattctgatttggggttgaatcctgtgtctcaaggtactgttattcgt
gtgccaatgcctgcgttgactgaagaacgtcgtcgagaattaactaaggtggtgaaaagc
gaaggcgaagatgcgaagatcgctgtacgcaatttacgtcgtgatgcaaacgagcatctc
aagcgtttgacgaaagataaagaaatctctgaagatgatgaacgtcgtgctactgacgat
attcaaaagatgactgataaagccgtgattgatattgataagatcattgctgaaaaagaa
aaagagatcatgacggtttaa

DBGET integrated database retrieval system