KEGG   Polynucleobacter necessarius: Pnec_0511Help
Entry
Pnec_0511         CDS       T00683                                 

Definition
(GenBank) undecaprenyl diphosphate synthase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00900  Terpenoid backbone biosynthesis
pne01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pnec_0511
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:pne01006]
    Pnec_0511
Enzymes [BR:pne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     Pnec_0511
Prenyltransferases [BR:pne01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Pnec_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-ProteinID: ACB43774
UniProt: B1XTU7
Position
461330..462103
Genome map
AA seq 257 aa AA seqDB search
MTQHTSSTLAIPEVSAVPRHVAIIMDGNGRWASKRMMPRVAGHSEGLSAVRKIVQECRKL
GVEYLTVFAFSSENWRRPPEEVGFLMKLFLKSLKGEVSRLAENDIALRLIGDLSRFNSAI
QEMVEFSEKKTAGCKGLTFTIAANYGGRWDILQAMRQCLVANPNLKPEQVSEELLQPHLS
MAYAPEPDLFIRTGGEQRISNFLLWQLAYTELYFTDILWPDFDEKELHKAFDWFSQRERR
FGRTSAQLVSQATSDAV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacacaccagttcaaccctagccattccagaggtcagtgctgtacctcgccat
gtggcgatcatcatggatggtaatgggcgctgggctagcaaacggatgatgccacgcgtt
gctgggcattctgaaggattgagtgctgttcgtaaaattgttcaagaatgtcgcaagctt
ggggtggagtatttaacggtattcgccttcagttctgagaactggcgacgtccaccagaa
gaggtgggcttcttgatgaagctgtttctcaaatcgctgaagggcgaagtatcccgtctt
gctgaaaacgatattgccttgcgattaattggcgacctaagccgttttaattccgctatt
caagagatggtagagttttctgagaaaaaaacagctggttgcaagggcctgacttttact
attgccgcgaactatggtgggcgctgggatatcttgcaagcaatgcgccaatgccttgtg
gctaatcctaacctaaaaccagagcaggtaagcgaagagttgttgcagccgcatctttca
atggcatatgcacctgagccggatttatttattcgcaccggtggcgagcaacgcataagc
aatttcttgttgtggcagttagcctacacggaactgtatttcacagatatcttgtggcct
gactttgatgaaaaggaattacacaaagcgtttgactggtttagccagcgcgagcgccgc
tttggtcgtaccagtgctcagcttgtatcgcaagcaacgagcgatgcagtttaa

DBGET integrated database retrieval system