KEGG   Polynucleobacter necessarius: Pnec_0512Help
Entry
Pnec_0512         CDS       T00683                                 

Definition
(GenBank) phosphatidate cytidylyltransferase
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00564  Glycerophospholipid metabolism
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
Module
pne_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pnec_0512
Enzymes [BR:pne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     Pnec_0512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_1
Motif
Other DBs
NCBI-ProteinID: ACB43775
UniProt: B1XTU8
Position
462130..462957
Genome map
AA seq 275 aa AA seqDB search
MLKTRIITALVLLAVLLPILFLLPPIYIGGFFLVALLAAAWEWSRLLAPEAGRAAWIYAL
FCLAIILFLLGMQNASWQFALLLLAVIFWFFVAPFILAKGMNLTLQKLRPFYVVLGLILL
PATWIALVFLRELGLIFLLSAMALVWVADIGAYFVGKAFGKHKLAVQISPGKSIEGAVGG
LILCYVYAFSCVYFLSFESTLFGAWAIRFGWVPMFMMVTVLAAFSIFGDLFESQLKRLAG
VKDSSHLLPGHGGVLDRVDALIPTMPIAALLAGFV
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaactagaatcattaccgcccttgtcttgttggcggtactactgcctatccta
ttcttgctccccccgatttatattggtggcttttttttggtggctttattggctgctgct
tgggagtggagccgattgcttgcgcctgaggcaggacgcgctgcttggatatatgcatta
ttttgtttggccattattttgtttttgcttggcatgcaaaatgcctcctggcagtttgct
ttattgctgctagcagtcatattctggttctttgtagcaccatttatattggccaaaggc
atgaatttgactttacaaaagttgcgccctttttacgtcgtactcggcttaattttgttg
ccagcaacttggattgcattggtgttcttaagagagcttgggcttatctttttgctcagt
gcgatggcccttgtatgggtggctgatatcggcgcctactttgttggtaaagcatttggc
aagcacaagcttgcggtgcaaattagccctggaaaatcgattgaaggcgcagttggcggc
ctaatactttgttacgtttatgcattctcatgcgtttactttttatcctttgaatctact
ttattcggtgcatgggccatccgttttggatgggttcctatgttcatgatggtgacggtc
ttagcggctttcagtatttttggggacttatttgagtctcagttaaagcgcttggcagga
gtaaaggattccagtcatttattgccaggtcatggcggtgtgttagatcgcgttgatgct
ttgataccaacgatgccaattgcagcactcctagcgggatttgtgtga

DBGET integrated database retrieval system