KEGG   Polynucleobacter necessarius: Pnec_0513Help
Entry
Pnec_0513         CDS       T00683                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00900  Terpenoid backbone biosynthesis
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pnec_0513
Enzymes [BR:pne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Pnec_0513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACB43776
UniProt: B1XTU9
Position
462957..464153
Genome map
AA seq 398 aa AA seqDB search
MPVKQVAILGSTGSIGVNTLDVIRAHPDRFKVVALTAAKQVDLLAQQCAEFKPAIAVVAN
ADGAARLSKLLLEKKINTQVLYGPEALVTAVVESGCDAVMAAIVGAAGLVPAMAAAKAGK
RVLLANKEALVMSGDLFMQAMKGGGGELLPIDSEHNAIFQCLPDQFSKEPNPRLGVEELW
LTASGGPFRNAPLDQLASITPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAFWLFGLP
LKKIKVLIHPQSVVHSMVRYRDGSVLAQLGQPDMRTPIAYGLAWPERIDAGVAPLSLTQL
AALSFAEPELEHFPCLSLAFAAAKAGGTAPAVLNAANEIAVAAFLDEGLPYLQIPVVVEK
VLGVISRTNADSLELILGVDAQARQAAQAAVKEVLCRR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgaagcaagtagccattctgggctccaccgggtctatcggtgttaatacactt
gatgttattcgagcccatccagatcgatttaaggtagtcgcgctcactgcagcaaagcag
gtagatttgctagctcagcaatgcgcagaatttaagcctgcgattgctgttgttgccaat
gctgatggcgcggcccgcttaagtaagcttttgcttgagaaaaaaatcaatacgcaagtt
ttatatggaccggaagccttggtaactgccgttgtcgaatctggctgtgacgccgtgatg
gctgcaattgtgggtgcagccggattggttcctgcaatggctgctgccaaagccggcaaa
agagtgttgctggcaaataaagaagccttggtaatgtctggtgatttatttatgcaagca
atgaaagggggtggtggcgagctattgccgattgacagtgagcacaatgccatctttcaa
tgtctacccgatcaattttctaaagaaccaaacccacgtcttggggtcgaagaactttgg
ttaactgcttctggtgggccattcagaaacgcgccgcttgatcaacttgcgagcattact
cctgaacaagcttgcgcacatcccaattgggtgatgggtagaaaaatttctgtagattcg
gcaacgatgatgaataaaggtcttgaggtcatcgaggcattttggctgtttggtttacct
ttaaagaaaattaaagtattgatacatccgcaaagtgttgtgcattcgatggttcgctac
cgtgatggatcagtcctcgcgcaattaggtcagccagatatgcgtacgcccattgcatat
ggtctggcatggccagagcggattgatgcaggtgtggcgccattgagtttgacgcagtta
gcagctctcagctttgccgaaccagagttggagcactttccttgtctctctttagctttt
gctgctgctaaagctgggggtactgcgccagcggtgctcaatgctgccaatgaaattgca
gtagccgctttcttggatgaaggtctgccatatttgcagataccagttgtagtagagaag
gtgctgggcgttatttctagaacaaatgcagattcgctggagttgatcttgggtgtggat
gcgcaggctcgacaagcagcgcaagcggcggtgaaggaagttctttgcaggcgctaa

DBGET integrated database retrieval system