KEGG   Polynucleobacter necessarius: Pnec_0515Help
Entry
Pnec_0515         CDS       T00683                                 

Definition
(GenBank) outer membrane protein assembly complex, YaeT protein
  KO
K07277  outer membrane protein insertion porin family
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pne03029]
    Pnec_0515
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pne02000]
    Pnec_0515
Mitochondrial biogenesis [BR:pne03029]
 Mitochondrial protein import machinery
  Outer membrane
   TOB/SAM complex
    Pnec_0515
Transporters [BR:pne02000]
 Other Transporters
  Pores ion channels [TC:1]
   Pnec_0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POTRA Bac_surface_Ag POTRA_2 Tox-MPTase4
Motif
Other DBs
NCBI-ProteinID: ACB43778
UniProt: B1XTV1
Position
465271..467616
Genome map
AA seq 781 aa AA seqDB search
MNSLTSSFRIFARLIAHILVLFALGLSLNASAADSFVVKDIRVEGLQRVEPGTVFSYLPV
QVGDTFTEEKGADVIKALYSTGFFRDVQIQAQGAVLIVIVKERPTISRIEFTGMKEFDNE
IVRKSLKTVGVAEARFYDKALIDKAEQELKRQYVGKGMYTAEVVATVTPVERNQVAIYFN
IDEGPVAKIQEINFIGTEVFSESTLKSEMQLKTGGWLSWYSKDNLYSKQKLTADLESIRS
YYLNRGYLEFVIESTQVSITPDKKGVYLTISVREGKKFTVKDVRLAGETLGKEAELMQLI
VLKPGDTFSTARLTESTKAIAEVLGSYGYAFATINSQPDLRRDLSEVDLTLVVDPGRRIY
VRQVAISGNAKTRDMVIRREMRQFESSWFDSDKIDLSKKRLGRLGYFTETDITTEDVPGS
PDQVDVNVKVTEKPTGAITLGAGFSSTEKLILSAGINQDNAFGTGTAIGLNASLGKITQN
LTLSNYDPYFTEDGISRYTDLYYRSSKPLYYVGDPDYQIKSVGSNIKFGVPYTEVDRVFF
GTGIEAFQIKTTVNTPQPYLTYAQSYGIPAPGYPDTLNTYNIPVAVGWARDGRDSSLIPS
TGSLEQLSGEVGTPAGNMNFYRLYGQYQKYHSFSKGNILSFNGEVGYGQGYGNHPFPITK
NYYVGGIGSVRGYSPGSLGPTYQNINGQILPTGGQSKIVSNLEYTFPVPGSGVDKTLRLF
TFVDGGNAFGQNINLVLRYSYGLGLSWISPLGPLKFSYGIPYKSQPTDNIQRLQFQVGTA
F
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
ttgaattctctgacatcatcgttccgtatttttgctcgcctcattgctcatatcctggtt
ttgtttgcgctaggtttgagtttgaatgcttctgcggctgattcttttgtggtgaaggat
attcgcgttgaaggtctgcagcgtgtagagcctggcacggtatttagttatttgcctgtt
caagttggtgacacctttaccgaagaaaaaggtgccgatgttattaaggccctctatagc
actggtttttttagagacgttcagattcaggcgcagggtgctgtattgattgtgatcgtt
aaggagcgcccaacgatatcccgtattgaatttacagggatgaaagagtttgataacgag
atcgttcgtaaatctttaaaaacagtcggcgtggccgaagctcgtttttacgacaaggcc
ctgatcgataaggccgagcaagaattaaagcgtcaatatgttggtaaaggtatgtataca
gcagaagtggttgctaccgttactccagttgagcgcaatcaagtggcaatttacttcaat
attgatgaaggccctgttgccaaaattcaagaaattaatttcattggtaccgaggtattt
agcgagagcaccctgaaaagcgaaatgcaactcaagaccggcggatggctgtcttggtac
agcaaagacaatctttactctaagcaaaaattaactgccgacttagaatctattcgatct
tactatctgaatcgtggttatctcgagtttgtgattgagtcaacccaggtttcgattact
ccggataagaaaggcgtctatctcactatcagcgttcgtgagggcaagaaattcaccgtt
aaggatgttcgcttagcgggagaaactcttggtaaagaagccgagttaatgcagttgatt
gttttaaaaccaggagacactttctcaacagctcgtttgactgagagtacaaaggcgatt
gctgaggttttgggttcttatggttacgcttttgcaaccattaattcgcaacccgatctt
cgtcgcgatctgtcagaagtcgatctaactttggttgtcgatccaggtcgtcgtatctac
gttcgccaggtagccatttcaggtaacgccaagactcgtgatatggtaatccgtcgtgaa
atgcgtcagtttgaaagctcatggtttgatagtgacaagattgacttatctaaaaagcgt
ttaggacgcttgggctattttactgagacagatatcactacagaagatgttcctggatct
cctgaccaggttgacgttaatgtgaaggtgacagaaaagccaactggagcaatcacgctt
ggtgccggcttctcctcaactgaaaaattgattttgtctgcaggtattaaccaagacaac
gcatttggtacgggtactgcgattggtttgaatgcgtctttgggtaagattactcaaaac
ttaactctttctaactacgatccgtatttcacagaagatggtattagtcgctacacagac
ttgtactatcgttcatccaagcctttgtactatgttggcgatcctgattatcaaattaaa
tcggtaggctccaatattaagtttggcgttccttatactgaagttgatcgtgttttcttt
ggtactggtattgaggcctttcagattaaaacaacggttaatacaccgcagccttatctg
acttatgcacaaagctatggtattcctgctccaggatatcccgataccttaaatacttac
aacattccagttgctgtgggatgggcgcgcgatggtcgcgatagctctttaataccgtca
accggatcattggagcaattatcgggagaggtgggtactccagccggtaacatgaatttt
taccgactgtatggtcagtatcaaaagtaccattccttctctaagggaaatatcttgtct
tttaacggcgaggttggttatggtcagggctacggaaatcatcctttcccaattaccaaa
aactactatgtgggtggtattggctcagttcgtggctactccccaggttcgcttggtcca
acctatcaaaacatcaatggtcaaattctgccaacaggcggccaatctaagattgttagt
aatttagagtacacattcccggttccgggctctggtgttgataagaccctgcgcctcttt
accttcgtggatggcggtaatgcctttgggcaaaatatcaatctagttttgcgatactcc
tatggattgggtttatcatggatatcaccactggggcctttgaagttcagctatggcatt
ccgtacaagtcgcaaccaacggacaatatccagcgtttacagttccaagtgggaacagcg
ttttaa

DBGET integrated database retrieval system