KEGG   Polynucleobacter necessarius: Pnec_0516Help
Entry
Pnec_0516         CDS       T00683                                 

Definition
(GenBank) outer membrane chaperone Skp (OmpH)
  KO
K06142  outer membrane protein
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Pnec_0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpH DUF1640 PqqD Exonuc_VII_L AAA_11
Motif
Other DBs
NCBI-ProteinID: ACB43779
UniProt: B1XTV2
Position
467635..468162
Genome map
AA seq 175 aa AA seqDB search
MKLYQSSKWIQAGLFAAVTALVAPQVFAQDAGTRVAVVNSEKVFNESNLAKAMQTRLQNE
FTKRQNDLRDSAQRIKSAAEKLDRDAAVMNEAERIRRQRELADQDRELQRKQREFTEDLN
QRTFEERAKIAEKANAVLKQIAEQRKIDVIVQEAAYVSPKADVTDDVIKTLNSLK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttatcaatcttccaaatggatacaagcgggcctatttgctgcagtgacggct
ttagtcgccccacaggtttttgctcaagatgcgggcacccgtgttgcggttgtgaactct
gagaaagtatttaatgagtccaatcttgcaaaagcaatgcaaacccgtttgcaaaatgaa
tttacgaagcgtcaaaatgatttgcgcgatagcgcgcaaagaattaagtctgcggcagaa
aagcttgatcgtgacgcagccgttatgaatgaagctgagcgtattcgtcgtcaacgtgag
ttggctgaccaagatcgcgaattacaacgtaagcaacgtgagttcactgaagatctaaat
cagcgtacttttgaagaacgtgccaagatcgcagaaaaagcaaacgcagtgttaaagcaa
attgctgaacagagaaaaattgatgtcattgttcaagaagcagcttatgtcagcccaaaa
gccgatgtaactgatgatgtcatcaaaaccttgaatagtcttaagtaa

DBGET integrated database retrieval system