KEGG   Polynucleobacter necessarius: Pnec_0518Help
Entry
Pnec_0518         CDS       T00683                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00061  Fatty acid biosynthesis
pne00780  Biotin metabolism
pne01100  Metabolic pathways
pne01212  Fatty acid metabolism
Module
pne_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Pnec_0518
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Pnec_0518
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pne01004]
    Pnec_0518
Enzymes [BR:pne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Pnec_0518
Lipid biosynthesis proteins [BR:pne01004]
 Fatty acid synthase
  Component type
   Pnec_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas PS-DH DUF2808
Motif
Other DBs
NCBI-ProteinID: ACB43781
UniProt: B1XTV4
Position
469282..469731
Genome map
AA seq 149 aa AA seqDB search
MSTPIAIDINKILKLLPHRYPFLLVDRVLEISPRESITALKNVTMNEPFFQGHFPGFPMM
PGVLIIEALAQTAALLTFSDERAEDAIYYFAGIDGARFKKPVLPGDQLIMTAKLERDRAG
IYKFAVQATADGEIAAEANITCAVRTKGA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaccaatcgcaatcgacattaataagattcttaaattgttaccgcatcgctac
ccatttttgttggtagatcgtgtattggaaatctctccgcgtgaaagtattaccgcatta
aagaatgtcactatgaatgagccattttttcagggccattttcctggcttcccaatgatg
cccggagtgctcatcattgaagccctagcacaaacagctgctttattaactttctcagat
gagcgtgcagaggatgcgatttactacttcgcaggtattgatggtgctcgttttaaaaag
ccggtgctacctggtgaccagttgatcatgactgcgaagttagagcgcgaccgtgcgggt
atatataagtttgcggttcaggcaactgctgatggtgaaattgctgcagaagcgaatatc
acctgtgcggttcgtacgaaaggcgcgtaa

DBGET integrated database retrieval system