KEGG   Polynucleobacter necessarius: Pnec_0524Help
Entry
Pnec_0524         CDS       T00683                                 

Definition
(GenBank) protein of unknown function DUF299
  KO
K09773  [pyruvate, water dikinase]-phosphate phosphotransferase / [pyruvate, water dikinase] kinase [EC:2.7.4.28 2.7.11.33]
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pnec_0524
Enzymes [BR:pne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.28  [pyruvate, water dikinase]-phosphate phosphotransferase
     Pnec_0524
   2.7.11  Protein-serine/threonine kinases
    2.7.11.33  [pyruvate, water dikinase] kinase
     Pnec_0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kinase-PPPase
Motif
Other DBs
NCBI-ProteinID: ACB43787
UniProt: B1XTW0
Position
complement(473408..473806)
Genome map
AA seq 132 aa AA seqDB search
MNFELNSIVAKANGLILDMFQTFVAPLEEALGMKSTHAMNRLHHNADTEAYKNRIEAINY
SLAHDDGQSNQNLAEVDVILIGISRVGKTPTSLYLAMQYGLKAANYPLIPEDFERGQLPK
DLVPYHQKILAS
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
gtgaactttgagctcaattctattgttgcaaaggctaatggtctcattttggacatgttt
cagaccttcgtggcccctcttgaagaagcattgggcatgaaatccactcacgccatgaac
cgtctacaccacaatgcggacaccgaggcttacaaaaaccgtattgaggcgattaactac
tcactggcccacgatgatggccaatccaatcaaaacctagctgaagtcgacgttattctg
attggcatctcccgggtgggaaaaacaccaaccagcctttatcttgcaatgcaatacgga
ctcaaagcagcaaactacccactgattccggaagactttgagcgcggacagctgcccaag
gatttagtgccttatcaccaaaaaatcttggcctcatga

DBGET integrated database retrieval system