KEGG   Polynucleobacter necessarius: Pnec_0526Help
Entry
Pnec_0526         CDS       T00683                                 

Definition
(GenBank) SsrA-binding protein
  KO
K03664  SsrA-binding protein
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    Pnec_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SmpB
Motif
Other DBs
NCBI-ProteinID: ACB43789
UniProt: B1XTW2
Position
complement(474136..474588)
Genome map
AA seq 150 aa AA seqDB search
MSIVDNKKAFFDYFIEERFEAGLVLEGWEVKAIRAGCVHIKEAYVVIRKAELFLTGCHIT
PLLSTSTHIVPNNTRTRKLLLNAIEIRKLIGKVEQKGYTLVPLNLHFSKGNVKCEIGLAR
GKKQHNKRAATKEREWEVQKGRIARGDLNA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgtcgataacaaaaaagccttctttgattattttatcgaggagcgctttgag
gccggacttgtgctggaaggctgggaagtgaaagccatccgcgcaggctgcgtgcacatt
aaagaagcgtatgtcgtcattcgcaaggcggagctattcctgactggctgccatatcacc
cccctgctatcaacctcaacccatattgttcccaacaacacccgcaccagaaagctctta
ctcaacgccattgagatccgcaaactgattggtaaggttgagcaaaaaggctataccctc
gttccactgaacctgcatttctccaaggggaatgtgaagtgcgaaattggcctcgctaga
ggcaaaaagcagcataacaagcgagcagccaccaaagagcgagagtgggaagtgcaaaaa
ggccgtattgccagaggcgatttaaacgcttaa

DBGET integrated database retrieval system