KEGG   Polynucleobacter necessarius: Pnec_0548Help
Entry
Pnec_0548         CDS       T00683                                 

Definition
(GenBank) glycosyl transferase family 9
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_9 Glycos_transf_1
Motif
Other DBs
NCBI-ProteinID: ACB43808
UniProt: B1XTY1
Position
complement(487560..488819)
Genome map
AA seq 419 aa AA seqDB search
MSISVNTMRAIDHWVGVPLCAIVSPVIALLDGVKNIYNRGPETPKKLLFIELSEMGSAIL
VDPAMRNAEARGAELFFLIFKSNRASLTLLNTVKPENIFTIDSSSLGGLIKDTLRFLVLA
RKHRIDTAIDLELFSRFTALLTGMCGARRRVGYHIFHGEGLWRGFMLTRKVHYNPHIHIT
KNFLSLIHAAFAQQIEVPFSKIEIPDSEVCLEQAIIDPNALEKVRERIEKLAKEANILYT
PGKDRLILINPNASDLLPQRRWAQQRFSELIQAIHQQYPDDLILITGSPAEFAYVEKVRA
VANIKNALNFAGQVSFAELPPLYTLSDVMVTNDSGPGHFSTVTSLRTVVLFGPETPALYG
SVGNSIAIAANLACSPCVSAANHRKTPCHDNVCMQAITVPQVLDKVIKQLKAADQAKAR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtctattagcgtcaatactatgcgcgccattgatcactgggttggcgtacctctttgt
gcaattgttagccctgttatcgccttgcttgatggcgtaaaaaatatttacaatcgcgga
ccagagactccaaaaaaattacttttcattgagctctctgaaatgggtagcgccattctg
gtagatccagcaatgcgcaatgcggaggcacgtggagcagagctgtttttcctgatcttc
aaaagcaatcgtgccagcctcaccctactgaatacagttaagcctgaaaatattttcaca
attgactcctctagtttgggcggcctgattaaagatacattgcgatttttagtattggct
cgcaaacaccgaattgataccgccattgatttggagctattttcacgtttcaccgcccta
ttaaccggcatgtgtggggcgcgtcgccgcgtgggataccatatttttcatggtgaagga
ttgtggcgtggcttcatgctgactcgcaaagtgcattacaacccgcacattcatatcacc
aagaactttctatctttgattcatgccgcttttgctcaacagattgaagttccttttagc
aagattgagattccagactctgaagtttgtcttgagcaagccatcatcgatccgaatgcc
ttagagaaagtccgtgagcgcattgagaagctggctaaagaggcgaacatactatacacc
ccaggaaaagatcggttgattctcattaatccaaatgcgagcgaccttttgccgcaacgt
cgttgggcgcagcagcgtttttcagaattaattcaagccatccaccagcaatatcccgat
gatttgatactcattactggctcaccggcagaatttgcttatgtagaaaaagtacgtgct
gtagctaatattaaaaacgcactgaactttgctggacaagtaagtttcgctgaattgcca
cctctgtacaccttgtccgatgtgatggtgaccaatgattctggtcccggtcacttttct
acagtaacatcgttgagaacagttgttctctttggcccggaaactcctgcgctttatggc
tcagttggaaattccatagccattgctgctaacttagcttgctcaccttgcgtgagtgcc
gccaatcaccgtaaaacaccatgccatgacaacgtctgcatgcaagccatcacagtgccg
caggtactggataaggtaataaagcaattaaaagctgctgatcaggcaaaggctcgttaa

DBGET integrated database retrieval system