KEGG   Polynucleobacter necessarius: Pnec_0557Help
Entry
Pnec_0557         CDS       T00683                                 

Definition
(GenBank) heavy metal transport/detoxification protein
  KO
K07213  copper chaperone
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMA
Motif
Other DBs
NCBI-ProteinID: ACB43814
UniProt: B1XTY7
Position
494628..494798
Genome map
AA seq 56 aa AA seqDB search
MTCGGCINAVTRATQAQDPQAKVQADLATQTVTLETILSPAQASQLITDAGFPVAE
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atgacttgtgggggttgtattaacgctgtaactcgggcaactcaagcccaggacccacaa
gcaaaagttcaggcggatttggcaacccagaccgtgacccttgaaaccatcctatcgccg
gcccaagcgagccagcttataacagatgcaggctttccggttgctgaatag

DBGET integrated database retrieval system