KEGG   Polynucleobacter necessarius: Pnec_0559Help
Entry
Pnec_0559         CDS       T00683                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Pnec_0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1 FGGY_C Gly-zipper_YMGG
Motif
Other DBs
NCBI-ProteinID: ACB43816
UniProt: B1XTY9
Position
495593..496534
Genome map
AA seq 313 aa AA seqDB search
MNGFHDAANSIATVVSTGVLKPQQAVVFATFFNFLAIFIFHLSVAATVGKGIVHPAAVDL
HVIFGALVGAIIWNVITWYYGIPSSSSHALIGGLVGAALPKAGIDGLVWSGIIKTVSFIF
ISPFVGFLLGSLMMLIVAWVCRNANLAKTDRWFRRLQLLSASVYSLGHGGNDAQKTIGII
WLLLIITGYAEAGAKMPPIWTIICCYIAIAMGTMFGGWRIVKTMGQKLTKLKPVGGFCAE
TGGAITLFAATALGVPVSTTHTITGAIVGVGSTQRASAVRWGVAGNIVWAWIFTIPATAL
MSMAVYYLSLLIF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaatggttttcatgatgcggccaactccattgcgactgtggtttcaactggggttttg
aagccgcaacaagcagtcgtatttgctaccttctttaactttctggcaatcttcattttt
catttaagcgtggctgctacagtgggtaaggggatcgtgcatcctgccgctgttgatctg
cacgtcatctttggtgccttggtgggcgcaattatttggaacgtgattacttggtattac
ggcattccatcaagctcttcccatgcattgattggcggcttagttggcgcggcattacct
aaggctggcatagatggattggtttggtctggaattatcaaaacagtttcctttattttt
atctccccatttgttggtttcttgcttggctctttgatgatgttgatcgttgcatgggtt
tgcagaaacgccaacttagctaaaaccgatcgctggttccgccgcttacagttattatct
gcgagcgtttacagcttgggtcacggtggtaatgatgcgcaaaaaactatcggcatcatt
tggcttttgctcatcattactggctatgctgaagccggcgccaagatgccgccgatctgg
acaattatttgttgctacattgcgattgcaatgggcaccatgtttggtggttggcgtatc
gtcaaaactatggggcagaaactaaccaagctcaagcctgtaggcggtttctgtgccgag
acaggtggtgcgatcacgttattcgcagcaacagctttgggtgttcccgtttctactacc
cacacaattactggggctattgttggtgttggttcaacccaaagagccagtgcagttcgt
tggggtgttgctggaaacatcgtgtgggcctggattttcaccatcccagctaccgctttg
atgtccatggcggtttattacctaagtctgctcattttctaa

DBGET integrated database retrieval system